KEGG   Wolbachia sp. wRi: WRi_002960Help
Entry
WRi_002960        CDS       T00866                                 

Definition
Malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
wri  Wolbachia sp. wRi
Pathway
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wri00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    WRi_002960
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WRi_002960
Enzymes [BR:wri01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     WRi_002960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(312378..313781)
Genome map
AA seq 467 aa AA seqDB search
MTKESLVKTDIVKVEDKKAVRSFFKILGGVADAVRSWIGNISPDLSNSRDIDSLVLKMNE
CLNPKGGEVSARKNAVSLGNLYLSLSEKGKIKFLQTLAEKFNPNKAEIDEKIKEYKKNQD
PELNYKFEQDLIKILESPRSKILKQFISLPEGLKFIVDMRSDVLKLKNQHRSLNPLENEL
KNILYTWVDVDLLDLRQITWDSPASLLEKLIKYEAVHKISSWGDLKNRLDSDRLCFAFFH
YKIPNEPLIFVEVALVDKIADSIQHLLDESVPSNDPSNASTAIFYSISNTQAGLSGISLG
NFLIKRVVEKLSQEFKSIKTYATLSPIPGFTKWLKNNLNQDVTLLGKLNIKQSSAEILES
AEQLKTNVECTNETKQYMLKLCAYYLLKVNNSNGNTYDPVAHFHLSNGASIKQLNWMADT
SEKGISQSAGMMVNYLYELPKIDNNHENYMVNKVISCSKKVSSMLKE
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaatcattggtaaaaactgatatagtgaaagttgaagacaaaaaggcggta
agaagcttttttaaaatactaggtggagtggcagatgctgtaagatcgtggattggtaac
atcagtcctgatttaagcaacagtcgcgatatcgatagtttagtcttgaagatgaacgag
tgcttaaatccaaagggaggggaggtttcagcacgtaagaacgctgtatctcttggtaac
ctgtacttgagcttatcagagaaaggtaaaataaaatttctacaaaccctggcagaaaaa
tttaatccgaataaagcggaaatagatgagaaaattaaagagtataagaaaaaccaagat
cccgagttaaactataaatttgaacaggatttaataaaaattcttgaatcaccgcgttct
aaaatattaaagcaatttatttctttaccagaaggccttaagtttattgttgatatgcgt
tctgatgtgcttaagctaaaaaaccaacatagaagcttgaatccactagagaacgaatta
aaaaatatactctatacttgggttgatgttgatctactcgatcttcgtcaaatcacttgg
gattcacctgcatcattgctagaaaaacttataaaatatgaagctgtgcataaaatttcc
tcttggggcgacctaaaaaacagactagattctgatcgtctctgttttgctttttttcat
tacaagataccaaacgaacctctaatttttgtagaggttgcattggtggataagattgca
gatagcattcaacaccttttagatgagtcagtaccttcaaatgatccgagtaatgcaagc
actgctatattctattcaatatcaaatactcaagcagggttatctggaatcagccttggt
aattttttgatcaaaagggttgtagaaaagctatcacaagaatttaaaagtataaaaaca
tacgcaactctttctccaatacctggctttacgaaatggctaaaaaacaatctaaaccaa
gatgtcactttattgggcaaactaaacataaaacaatctagtgcagaaattttagaaagt
gcagagcaattaaaaactaatgttgaatgtacaaatgaaactaaacaatacatgcttaaa
ctatgtgcatattatttactaaaagtgaataatagtaatggaaatacttatgacccggtg
gcgcattttcatttaagcaatggcgcatcaataaaacaattaaactggatggcggatact
tctgaaaagggtattagtcagtcggctggaatgatggtaaattatctgtatgagttgcct
aaaatagataataatcatgaaaactatatggttaataaagtgatttcctgctcgaaaaaa
gtgtcgtctatgttgaaggagtaa

DBGET integrated database retrieval system