KEGG   Wolbachia wRi (Drosophila simulans): WRi_003570Help
Entry
WRi_003570        CDS       T00866                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:wri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WRi_003570 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WRi_003570 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    WRi_003570 (sucB)
Enzymes [BR:wri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WRi_003570 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
381869..383041
Genome map
AA seq 390 aa AA seqDB search
MSKIIEIRAPKTLGGESVTEGIVKIKKGIGEAVKVDDLIFEIETDKTALELTAEASGQIT
EFLVKEDDVISPDQLLAKLSVGEVKEEAKKEDKSESAAKKDAPSARKIMEENAISAESVK
GTGMGGRITKADVIGHMNKAEQPAIKQYELPKSVVNGEQREERVKMSKIRQVIAARLKAS
QNTAAILTTFNEIDMKNVMDLRTKYKDAFEKKYGIKLGFMSFFIKAAVQALKEIPEINAE
ISGDEIIYKHYYDIGVAVGTDKGLVVPVIRSADQMSFAEIELTLVALGKKAREGKLQVSE
MEGATFTISNGGVYGSLLSTPIINPPQSGILGMHSIQNRPVAVGNAVEIRPMMYIALSYD
HRIVDGKGAVTFLVKIKNYIEDPNRLVLEV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaattatagaaatcagagcaccaaaaactcttggtggtgaatcagttacagaa
ggtatagtaaaaataaagaagggtattggagaagcagtaaaagtagatgatctgattttt
gaaattgaaactgacaaaacagcactcgaattaactgcagaagcttcagggcaaataact
gaatttcttgtaaaggaagatgatgtgataagtcctgatcaattgttagcgaagctttcc
gtgggagaagtaaaagaggaagcgaaaaaagaagataaaagcgaaagtgctgctaaaaaa
gatgctccatcagctcgtaaaattatggaagaaaatgcaatcagtgcagaaagcgtcaaa
ggaactggcatgggaggcagaataacaaaagcagatgtgataggccatatgaacaaagct
gaacaacctgcaataaaacaatatgaattgccaaaaagtgtagtaaatggagagcaaaga
gaggaacgagtaaaaatgagcaaaataaggcaagtaattgccgctcgtttgaaagcatcg
caaaatactgctgcaatactgaccacgttcaatgaaattgacatgaagaatgtcatggat
ctaagaacgaaatataaggacgcctttgaaaaaaaatatggaataaaacttggttttatg
tcgttttttataaaggcagcggtgcaagcactgaaagagattcctgaaattaacgctgaa
atctcaggcgatgaaatcatatataaacattactatgacataggtgttgctgttggcact
gacaaaggccttgttgtgccggttattcggagtgccgatcagatgtcatttgccgaaatt
gaattgactttagttgctcttggcaaaaaagcacgagaaggtaaattacaagtatcagaa
atggaaggtgcaacatttaccatttcaaatggcggagtatatggttcgctcctttctact
ccgataataaatcctccgcaatctggaatacttggaatgcattcaatacaaaacaggcca
gttgctgttggtaatgcagtagagatcagacctatgatgtacattgctctttcttatgat
cacagaatagttgatggcaaaggagcagtgactttcctcgttaaaataaaaaattatata
gaagatccaaataggttagttttggaagtgtag

DBGET integrated database retrieval system