KEGG   Wolbachia sp. wRi: WRi_008620Help
Entry
WRi_008620        CDS       T00866                                 

Gene name
folKP
Definition
Folate synthesis bifunctional protein
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
wri  Wolbachia sp. wRi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:wri00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(932453..933736)
Genome map
AA seq 427 aa AA seqDB search
MIYISIGSNMGNRFSHLQKAAQLLQERYFKNLKSSIILETKAILPNDAPPGWDRPFLNMV
VYGSCSSSPEELLKGLKQIECDIGRLQVYEKWAPRVIDLDILLWDDLTLDTPYLKIPHPE
LINRPFLLHLMAMLSPMAVVNKTFGTINPNIKDCFLRSFTLSPELVGIVNITPDSFSDGG
LYYDADQATKQALRLLSDGASIVELGAQSTRPGSSIQTPKAEYARLKPVLDNLNQYMKVG
DIKVSIDSFWPDVILNVLEHYNIAWVNDQKGDLDDNTLKAIASSGCSIVIMHSLSIPPHS
DNIIPSDIDPIDTINNWAERNINRLLALGFDQSSIIIDPGIGFGKSMYQNIQILRSIETL
QNFGCKVLVGHSRKSFISSFSTEPVFNRDLETIALSSALHNKVDFLRVHNVRDHMRFFVA
QAALQGC
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgatttacatttctattggctcaaatatggggaatcgcttttcccatttacaaaaggct
gctcagttactgcaggaacgctattttaaaaatttaaaatcttcaattattctggaaact
aaggctattttaccaaatgatgctccacctgggtgggacaggccatttctaaatatggtt
gtgtatggaagttgttcttcttctcctgaagagctgttaaagggccttaaacaaattgaa
tgtgacattggccgtctgcaggtctatgaaaaatgggcacctcgcgttattgatttggat
attttgttatgggatgacctgacacttgatacaccctaccttaagattcctcacccagaa
ttgataaacagaccatttttgcttcacttgatggcaatgctgagtcccatggcagtagtt
aacaaaacgtttggtactattaaccctaacattaaggattgctttttaaggagttttacg
ctttcaccagagcttgtaggtattgttaatattactcctgattcattttcagatggtggt
ctttattatgatgcagatcaagcaaccaagcaggcactgcggctgttatcagatggtgca
agcatagttgaacttggtgctcaatcaacaagacctggctcctcaatacaaactccaaaa
gcagaatatgcacgcttaaaaccagtgcttgataatctcaatcagtatatgaaagttggt
gacattaaagtcagcattgatagtttctggccagatgttattttgaatgttttggagcac
tacaacattgcctgggtaaacgatcagaagggagatctagatgataataccttaaaagcg
attgctagcagtggatgtagtatcgttattatgcattcactctccataccaccacatagt
gacaacattatcccaagtgacattgatccaattgataccataaataattgggcagaaagg
aacattaatagattactagctctaggttttgatcaaagctcgatcattattgatcctggt
attggttttggcaaatctatgtaccagaatatccagattttacgcagtatagaaacgtta
caaaattttggctgcaaagttctggttggtcattctagaaagtcatttatttcttctttt
tctacagaacctgtctttaaccgagatttagaaacaattgctttatcatctgcattgcac
aacaaggttgatttccttcgagtgcataatgtgcgtgatcacatgcgattttttgtagct
caagctgctttacagggatgctag

DBGET integrated database retrieval system