KEGG   Wolbachia wRi (Drosophila simulans): WRi_009400Help
Entry
WRi_009400        CDS       T00866                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
wri00900  Terpenoid backbone biosynthesis
wri01100  Metabolic pathways
wri01110  Biosynthesis of secondary metabolites
wri01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wri00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WRi_009400 (dxr)
Enzymes [BR:wri01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     WRi_009400 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: ACN95656
UniProt: C0R414
Position
1012091..1013254
Genome map
AA seq 387 aa AA seqDB search
MKKVSVLGSTGSVGKKTVDLLSKRKEEYQVEALSAHSNFALLAHQAKLLNAKYVAISDER
LYKDLKESLLGTDVKIAIGATNVAAIPVDLSVVAIVGIAGLGPVMEVIESGTKVIALANK
ESIVCGGKLLLKKAKEKNVQIIPIDSEHNAIFQILQNDDKCVEKIILTASGGPFLNYSLE
QLRNIMVDQALSHPTWNMGKKISVDSATMMNKALEIIEAHNLFNISPDKIEAVVHPESIV
HGIVTYKDGFNFAVLAETDMAIPISYALSWPERLVLNYKLDLTKQGKLTFQEPDHKHFPV
LKLSMEVLNSSTPQTNSIVLNAANEIAVNEFLKSRIGFLEIVEVVESTMESFGSYTDINS
LSDIINIDCESRIIAHKIVESKVVAYS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaggtttcagttttagggtcaacaggaagtgttggaaaaaagactgtagatttg
ctctcaaagagaaaagaagaataccaagtggaagcactaagtgcccattcgaactttgct
ctactggcacaccaagcaaaactgctgaatgcaaaatatgttgctatctccgatgaaaga
ctttacaaagatttgaaagaaagtctacttggtacagatgtaaaaatagcaattggtgct
acaaatgttgctgctatacctgttgatctctcagttgttgcaatagttggcattgcaggc
cttgggccagttatggaggttatagaaagcggtaccaaagtcattgcattggcaaacaaa
gaaagcattgtttgcggtggaaagttattactcaaaaaagctaaagaaaaaaatgtacaa
ataatccctattgactctgagcacaatgcaatttttcaaattttgcaaaatgacgacaaa
tgcgtagaaaagatcatacttactgcttctggtggaccattcttaaattatagccttgag
caattaagaaatatcatggtagatcaggcgcttagtcaccccacttggaatatgggaaag
aaaatctcggttgatagcgcaacaatgatgaataaggcactagagataatagaagcacat
aacttgtttaacatcagcccggataaaattgaagcagtagtgcatcctgagtcaatagta
catggaattgtaacttataaggatgggttcaactttgctgtgcttgcagaaactgacatg
gcaattcctatttcatatgctctatcttggccagaaagattagttttaaattataaatta
gatttaacaaagcaaggaaaattgacctttcaagagccagaccataagcatttccctgtg
ctaaagcttagcatggaagtgttaaactcttctactccacaaacaaacagtattgtgctc
aatgctgcaaatgaaatagctgttaatgaatttttgaagtcacgaatcggctttttggaa
atagtagaggtagtggaatcaacaatggaaagttttggtagttataccgatattaattca
ctatctgatataataaatattgattgtgaaagtcgtattattgctcacaaaattgttgaa
agtaaagttgttgcgtatagctag

DBGET integrated database retrieval system