KEGG   Wolbachia wRi (Drosophila simulans): WRi_011520Help
Entry
WRi_011520        CDS       T00866                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex, E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
wri00010  Glycolysis / Gluconeogenesis
wri00020  Citrate cycle (TCA cycle)
wri00620  Pyruvate metabolism
wri01100  Metabolic pathways
wri01110  Biosynthesis of secondary metabolites
wri01120  Microbial metabolism in diverse environments
wri01130  Biosynthesis of antibiotics
wri01200  Carbon metabolism
Module
wri_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WRi_011520 (aceF)
   00020 Citrate cycle (TCA cycle)
    WRi_011520 (aceF)
   00620 Pyruvate metabolism
    WRi_011520 (aceF)
Enzymes [BR:wri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     WRi_011520 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACN95846
UniProt: C0R4K4
Position
1241806..1243170
Genome map
AA seq 454 aa AA seqDB search
MPIEILMPALSPTMSKTGGKIVKWHKKEQDKVEVGDVIAEIETDKAIMEFESIDEGVLAK
ILVTEGTSGVPVNQPIALMLEEGEDESALNNYTSTSINSAVKKEVTKSAVDNQKSEHQDL
NGKPISHSSVSFQRVTLESNPSMSSQCLTLGSRKEEWIPVSATQMTEGYAEGRTKISPLA
KKIAQNEGVNVQQLKGTGPYGRIIKADVLEFLGSGIHTESPEKDTIVEVSNMRQVIAQRL
TESKQNVPHFYLTVDCQVDKLISLKNEINSADENNKVTINDLIIKAAAFSMKKFPDINSS
WIDNKILRYSNIDISIAVALEDGLITPIVKNADKKGILSISKEVKDLVSRARSGKLKPEE
FQGGGFTISNLGMFGIKAFSAIINPPQSCIMAVGASKKQPIVMNEKIEIAEIMTVTLSVD
HRAVDGALGAKFLNAFKHYIENPLVMLIETAVIY
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcctatagaaatattaatgcctgctctttcaccgacaatgagcaaaactggaggaaaa
attgtaaagtggcataaaaaagaacaagacaaagttgaagtaggcgacgtaattgctgag
atagagactgataaagccataatggagtttgaatctatagatgaaggagttttagcaaaa
attttagtaacagaaggaacaagtggcgtgcctgtaaatcaaccaatagctttaatgctg
gaagaaggagaagatgaaagtgcacttaacaactatacttcaacttccatcaatagtgca
gttaaaaaggaagtgacaaaaagtgctgttgataatcaaaaatcagaacaccaagattta
aacggaaagccaataagtcattcttcggtgtcattccagcgcgtgacgctggaatccaac
ccctcaatgtcatcccagtgcttgacactgggatctagaaaagaagaatggatcccagtg
tcagctactcagatgacagagggttatgcagaaggtagaacaaaaataagcccattagct
aagaaaatagctcaaaatgaaggggttaatgtgcagcaattaaaaggtacaggaccatat
ggtcgcataattaaggctgatgtgttggagtttttaggcagtggtatacatactgaaagt
cctgagaaagataccatagttgaagtaagcaacatgcgccaagtgatagcacagcgcctg
actgaatcaaaacagaatgttccacatttttatttaactgtagattgccaggttgataag
ttaatatcgttaaaaaacgagattaactcagcagatgaaaacaataaagtaacaattaat
gatctaatcataaaagctgcagctttcagcatgaaaaaatttcctgatataaattcttcg
tggatagataataaaatactgagatattcaaatatagatatttcaatcgctgtggcactt
gaagatgggctaattactcctatagtaaaaaatgctgataaaaagggtattttatctata
tcaaaagaagtgaaagatttagtaagcagagcaagatctggaaaattgaaacctgaagag
tttcaaggaggagggtttactatctccaacttagggatgtttggtataaaagccttcagt
gctataatcaatccgccgcaatcttgcattatggcagttggtgcatctaaaaaacaacca
attgttatgaatgagaaaatagaaatagcagaaataatgacagtaacgctctctgttgac
catagagcagttgatggggcactcggagcaaagtttttaaatgcctttaagcattatata
gagaatcctctggtgatgcttattgaaactgcggtaatctattag

DBGET integrated database retrieval system