KEGG   Wolbachia wRi (Drosophila simulans): WRi_011550Help
Entry
WRi_011550        CDS       T00866                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
wri03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:wri00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WRi_011550 (recR)
DNA repair and recombination proteins [BR:wri03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     WRi_011550 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      WRi_011550 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: ACN95849
UniProt: C0R4K7
Position
complement(1245334..1245939)
Genome map
AA seq 201 aa AA seqDB search
MNINIKNLVHAFSKLPSLGPSSSRRLVIHLLQNKEKVMLPLASLIKELADLIIECEVCGN
LDTKSPCSICTNPKRDTKLLCVVEELGDLWAFEKGNIYSGLYHVLGGRLSAINGIGPKEL
NLDTILKKVTESKIEEIIIAINPTLEGQVTAQYIIELLKNLDVKISRLACGIPMGGEIDY
LDEGTLRIALTSRQEYELNIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaacataaaaaatctagttcatgctttctctaaattgccaagtttagggcca
tcatcatcacgcaggttagttatacatttactccaaaacaaagaaaaagttatgctacca
cttgcatctttgattaaagagctagcagatcttataatagagtgtgaagtttgcggaaat
ctagatactaagtcaccttgttctatttgtactaacccaaaacgtgacactaagttactg
tgtgtagtagaagaattaggtgatctatgggcgtttgaaaaaggaaatatatattcaggt
ttataccatgttttgggtggcagattgtctgcaataaatggcataggtccaaaagaactc
aaccttgacactattctgaaaaaagtgacagagtctaaaattgaagagataattatcgca
attaatccgacattagagggccaagttactgcacaatatataattgaattgctaaaaaat
ttggatgtgaaaatatcacgccttgcttgcggcataccaatgggcggagaaattgactat
cttgatgaaggaacgctgaggatagcacttacttcaagacaagaatatgagttaaatata
aaataa

DBGET integrated database retrieval system