KEGG   Wolbachia wRi (Drosophila simulans): WRi_011880Help
Entry
WRi_011880        CDS       T00866                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:wri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WRi_011880 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WRi_011880 (sucC)
   00640 Propanoate metabolism
    WRi_011880 (sucC)
   00660 C5-Branched dibasic acid metabolism
    WRi_011880 (sucC)
Enzymes [BR:wri01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     WRi_011880 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1279196..1280347)
Genome map
AA seq 383 aa AA seqDB search
MNIHEYQAKEVLHKFNVSVPKGFVATSAEEVKTQVSQLKSDVFVVKAQIHAGGRGKAGGV
KLAKSAEEAQQFVKDMIGMTLVTHQTGPSGQQVRKVYVEEGSSIKKEYYLSLVIDPKLSR
PIFIFSSEGGMDIEEVAKNSPAKIVKFDIDSATSFDSSKLSSSFHLSPEQIEKITNVAKN
IYDAFIATDASQIEINPLVETSSGDFIALDAKINFDDNALYRHPEIMELRDYDEEVKEEI
EASKYGLSYIKMDGSIGCMVNGAGLAMATMDIIKYYGAEPANFLDVGGGASKETVTEAFK
IILSDSNVKGILVNIFGGIMRCDIIASGIVAAAKEMSIKVPLVVRLSGTNFEEGKKILEE
SGLNIIAADELGDAAQKIVKEVK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaagcgaaagaagttttacataaatttaatgtctcagtgcca
aaaggttttgttgctacatctgcggaagaagtaaagactcaagtaagtcaattaaaatct
gacgtgtttgtagttaaagctcaaattcatgcaggtggtaggggtaaagccggtggcgta
aagctagcaaagtcagctgaagaagctcaacagtttgtaaaggacatgattggtatgact
ttagttactcatcaaacagggccaagcgggcagcaagtaagaaaagtgtacgttgaagaa
ggctcaagcattaagaaagagtattatttaagcctggtaatcgacccgaagctcagtagg
ccaatattcatattttcctcagaaggtggaatggacattgaagaagtggcgaaaaattct
cccgcaaaaattgtgaaatttgatattgattctgctacaagttttgatagcagcaagtta
agcagcagttttcatttgagtccagaacaaatagaaaaaataacaaatgttgcaaaaaat
atatatgatgcgtttattgcaactgatgcgagccaaattgaaattaatccactggttgaa
acaagttctggagattttattgcgctcgatgcgaaaattaatttcgatgataatgcttta
tatcgtcacccagaaattatggaacttcgtgattatgatgaagaagtgaaagaagagata
gaggcttcaaagtatgggctcagttacatcaaaatggatggcagtattggttgcatggta
aatggtgcaggtcttgctatggcaacaatggatataataaaatactacggagcagagcct
gctaactttttggatgttggtggtggagcgagtaaagaaactgtaactgaagcatttaaa
atcatattgtctgatagcaacgtaaaaggaattctggttaacatatttggtggtataatg
cgttgcgatattatcgcaagtggaattgttgcggctgcaaaagaaatgagcattaaagtt
cctctagtggttagattatcaggtactaattttgaagaaggaaaaaaaatcttagaagag
tcaggattaaatattattgctgcagatgaactgggtgatgctgcacaaaagatagtaaaa
gaggtaaaataa

DBGET integrated database retrieval system