KEGG   Wolbachia wRi (Drosophila simulans): WRi_012010Help
Entry
WRi_012010        CDS       T00866                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WRi_012010 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WRi_012010 (sdhD)
   00650 Butanoate metabolism
    WRi_012010 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    WRi_012010 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1291948..1292304
Genome map
AA seq 118 aa AA seqDB search
MSQSGNSVHHWWVQRVSAVILLFLFPWFIYSFSCTFYTDSSLSFSEKFINHPLELLFFVV
LLFCIFWHAVLGMQVVCEDYIHSVPLRIFTITCIKYLSSITYITLAFTIFIFYRRIFL
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagtctggaaattcagtacatcattggtgggttcagcgtgtttctgcggtaatt
ttactgttcctgtttccttggtttatctattcattttcttgcacattttatactgatagc
tctttgtcttttagtgaaaaatttattaatcaccctctagagcttttattttttgttgta
ttgttgttttgcattttttggcacgcagttcttggaatgcaggtagtatgcgaagattat
atacacagcgtacctttgaggatttttacaattacatgcataaagtacttatcaagcatt
acttatataaccctcgcttttacaatctttatcttctacaggcgtattttcttgtaa

DBGET integrated database retrieval system