KEGG   Wallemia mellicola: WALSEDRAFT_60496Help
Entry
WALSEDRAFT_60496  CDS       T03142                                 

Definition
(RefSeq) ferredoxin reductase-like protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
wse  Wallemia mellicola
Pathway
wse00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:wse00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    WALSEDRAFT_60496
Enzymes [BR:wse01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     WALSEDRAFT_60496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9 IRS
Motif
Other DBs
NCBI-GeneID: 18473984
NCBI-ProteinID: XP_006958608
JGI: Walse1_60496
UniProt: I4YBB2
Position
Unknown
AA seq 330 aa AA seqDB search
MFARNLQSISKFTRSYSTGPQQSSKGLYIGAAGALALFAGGYTLLNKDSSSGPLPASTSK
SDRIESLQTPQVALTKENFTNLTLKNVKKYNHDSSIFEFELPGSSVSGLETAGLVVVKAA
DDSVKGDNGKPVIRPYTPISTGDTRGQIDFLIKKYDDGKFTPYIHSLKPGDQLAIKGPLQ
KFKWVPNTYEKIGLIAGGSGITPMTQLAETILNNPEDKTKVTLLFANKTPEDILLKETLD
DWKKKYPEQFNVVYTIDKETPGWDGLVGYFTGDILKKNLPAPGSNGKTYVCGPPPMMKAI
SGNKTNKGAQGELTGILKELGYTEDQIFKY
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctaggaacttacaatcaatttctaaattcactagatcttactctactggccca
caacagagctccaaaggcttatacattggagccgctggtgccctcgccctcttcgctggt
ggatacacactcctcaacaaggattcctcttcaggtcctcttcctgcttcaacctcaaag
tctgacagaatagagagccttcaaacaccacaggttgctctcacaaaggagaacttcacc
aacctcacactcaagaatgtcaaaaagtacaaccacgattcttcaatctttgaatttgag
ctccctggttcctcagtatcaggtctcgaaacagctggtcttgttgttgttaaggcagct
gacgactccgtaaaaggtgataacggaaagccagttattagaccatacactcctatttca
accggagacacccgcggacaaatcgacttcttgattaagaagtacgatgacggaaagttc
actccatacatccactcactcaaaccaggtgatcaactcgccatcaagggtccattacaa
aagttcaaatgggtaccaaacacttacgaaaagattggtttgatcgctggtggtagtggt
attacaccaatgacacaattagctgagacaatcttgaacaacccagaagacaagacaaag
gttacactcttgttcgctaacaagacaccagaggatatcctcctcaaggagaccctcgac
gactggaagaagaagtatcctgaacaattcaatgtcgtttacactatcgataaggaaaca
ccaggatgggatggtctcgtcggttacttcactggtgatatcctcaaaaagaaccttcct
gcaccaggttccaacggaaagacctatgtttgtggtccaccaccaatgatgaaagctatt
tcaggtaacaaaaccaataaaggtgcacaaggtgaattgactggtatcctcaaggaatta
ggttacacagaagatcaaatatttaaatactaa

DBGET integrated database retrieval system