KEGG   Wolinella succinogenes: WS0018Help
Entry
WS0018            CDS       T00146                                 

Gene name
PLDA
Definition
outer membrane phospholipase A precursor (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
wsu  Wolinella succinogenes
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:wsu00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:wsu00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:wsu00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:wsu00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(18745..19863)
Genome map
AA seq 372 aa AA seqDB search
MSLRPLFFGALFLSSLLAEGRNLTLWLSEPDGTTRRLTGVKLEEKDQAIEILLPTKEGES
PRILHLLLTDEENGAKATPLIEQPTINKEQLRVVEIKPPGFKEESSNEEEEQPRLYREYH
DRKNLFGSFLGIIPHHPNYILPFSHSLNDRKGESKKTEAKFQISFKTLLAQSLWGSKFDL
YLAYTQRSYWQVYDGDDSRPFRESNYEPEIFLSYPTEIPLFGGRLEQVNFGLNHESNGKD
IEKSRSWNRAFIEGIYNHGNLFLGLKGWYRLPEKEKSSPLDPNGDDNPDIHNYLGYGDLK
IGYLLEKHLFSATLRNNLRSKGENRGSLLLDYSYPIQNHLYFYLQYFSGYGESLIDYNRS
VERIGAGFLFTR
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgcttcgccccctcttttttggcgctctttttctctcttctctcctagcagagggg
aggaatctcaccctttggctctcggaacctgatggcaccacgcgccgccttacaggggtg
aagctagaggagaaggaccaggcgatagagattcttctgcccaccaaagagggagaatcc
ccccgaatccttcatcttctcctcacggatgaagaaaatggcgccaaagctacccctctc
atcgagcagcccacgataaacaaagagcagctccgtgtggtggagatcaagcctcccgga
ttcaaagaagagagctcaaacgaggaagaggagcaaccacggctctacagggagtatcac
gatagaaagaatctctttggctcttttttaggaatcatcccccatcatcctaactacatc
ctcccctttagccatagcctcaatgaccgcaagggggagagcaaaaagaccgaagccaaa
ttccaaatcagcttcaaaactctcctagcccaaagcctttggggaagcaagtttgacctc
tatctcgcctacacccagcgctcctattggcaggtctatgatggggatgattcgcgcccc
tttagggagagcaactatgaaccagagattttcctctcctaccccaccgaaattcccctc
tttggagggagattggagcaggtcaattttggactcaaccacgaatccaatggcaaagat
atcgaaaaatcaagaagctggaatcgagcctttattgaaggcatctacaatcatggaaat
ctctttttggggctaaaggggtggtatcgactgcctgaaaaagagaagagctccccattg
gatcctaatggagatgacaatccagacattcacaactatctaggctatggagacctaaaa
ataggctacctgctagagaagcacctctttagcgcaaccctccgcaacaacctccgctcc
aaaggagagaatcgaggctcgcttctcctagactactcctaccccatccaaaaccacctc
tacttctatctgcaatatttcagcggatatggcgagagtctcattgactataatcgaagc
gtggagcgaatcggggcaggattcctcttcacgcgataa

DBGET integrated database retrieval system