KEGG   Wolinella succinogenes: WS0042Help
Entry
WS0042            CDS       T00146                                 

Gene name
WBPS
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
wsu  Wolinella succinogenes
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:wsu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42303..44135)
Genome map
AA seq 610 aa AA seqDB search
MCGIAGTLNSSCFSSKKLLAALAHRGPSGHGEFSHQGVNLFHARLSIQDLSPAGAQPMHR
HHLSIVFNGEIYNHLELRAKVADYPFSTRSDTETILALFERFGERSLEWMDGMFALAILD
QRTHKLFLARDRMGKKPLFYYQEGEEFLFASELNALLTLKPLQIDHAKLSAFLRCGFFPH
DGAPYQGVQSLPQGSYAFIDLHHPRPLSPQRYFDLLSLYQAPKIEGFEASKEAVELALKE
SVKNRLESSDLEVGSFLSGGIDSSLITALASFFTPKLKTFTVAFEGAYDESSLAELVAKR
YKTDHTTLHLNPSKLKEEVKGILACYGRPFMDSSAIPSYYVSQEAKKHLTVILNGDGADE
LFGGYRRYVPMSHGWLKLARPLSLLLPLLPLPKEKKSLYNYLHRLLAMSRKRGLDFYLSA
TIDSFEDAYAFSPNPHTQTLDQEITQILEDSSLSSLSKMLYLDSQNLLLSDLLPKMDIAT
MAHSLEGRSPFLGKSLLEVAPRIKDEYKIFGKSTKFILRELAKKYLPHALLEQPKRGFEV
PLRAWVEGELKELIFDSLSKNCLSRELIESRFVDALLDKPQDFAPEKRAKMLWSLFSLEV
WHEHYQKACE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgctggcaccctcaactcctcttgcttctcttcaaaaaaactcctcgcc
gccctagcgcatcgaggacccagcggtcatggggagtttagccaccaaggggtgaatctt
tttcatgcgcgcctctccatccaagacctgagtcccgcaggggcgcaacccatgcatcgt
caccatctctccatcgtctttaatggtgaaatctacaaccacctagagctgcgagccaag
gtggcagactaccccttttccacccgctcagacacggagacaattctcgccctctttgag
cgctttggagagcgctctttggagtggatggatgggatgtttgccttggccatcttagat
cagcgcacccacaagctcttccttgcacgcgatcgcatggggaaaaaacctctcttttac
tatcaagagggagaggagtttctctttgccagcgaactcaacgccctcctcaccctaaaa
cctctacaaatcgatcacgcaaaactctctgcctttcttcgatgcggattcttccctcat
gatggagccccctatcaaggagtccaatccctcccccaaggctcctacgccttcatcgac
ctgcaccatccaaggcccctctctccccagcgctactttgacctgctctccctctatcaa
gcccctaaaattgagggatttgaggcttccaaggaggcggtcgaactcgcgcttaaagag
agtgtaaagaatcgcctagagagctccgatttagaggtgggaagcttccttagtggagga
atcgactcttcgctcatcaccgctttagcctccttcttcaccccaaagcttaaaaccttc
acagtcgcctttgaaggagcctatgatgaatcttcactcgccgagcttgtcgccaagcgc
tacaagaccgaccacaccaccttgcacctcaacccctccaaactcaaggaggaggtgaag
ggaatcttggcttgttatggacgccccttcatggatagctcggcgattcctagctactat
gtgagtcaagaggccaaaaaacatctcaccgtcatcctcaatggcgatggagcggatgaa
ctctttggcggctatcgtcgctatgtgcccatgagccatggatggcttaaactggctcgc
cctctaagcctccttttgcccctgcttcccttgcctaaagagaaaaaatctctctacaac
tacctccatcgactcctagcgatgagccgaaaaagaggacttgacttctacctctccgcc
accattgacagctttgaggatgcctacgcctttagccccaatcctcacacgcaaacactt
gatcaagagatcacgcaaatccttgaggattcctccctctcgtccctctccaagatgctc
tatctcgatagccaaaacctccttctctctgatctgcttccaaaaatggatatcgcgacc
atggcgcactccctagagggtcgctctccctttcttggcaaatccctcctagaggtcgcc
cctagaatcaaggatgagtataaaattttcgggaagagtaccaaattcattctccgcgaa
ctggccaaaaaatatcttccccatgcccttcttgaacagccaaagcgaggctttgaggtg
ccccttagagcttgggtggagggggagctaaaagagcttatttttgattctctctccaaa
aattgcctctccagggagcttatcgagagccgttttgtcgatgctctccttgataaacct
caagattttgcccccgaaaaacgcgccaagatgctctggagcctctttagtctagaggtg
tggcatgaacactatcaaaaggcttgtgaatga

DBGET integrated database retrieval system