KEGG   Wolinella succinogenes: WS0157Help
Entry
WS0157            CDS       T00146                                 

Gene name
ACCD
Definition
(GenBank) CARBOXYLASE CARBOXYL TRANSFERASE
  KO
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
wsu  Wolinella succinogenes
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WS0157 (ACCD)
   00640 Propanoate metabolism
    WS0157 (ACCD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    WS0157 (ACCD)
Enzymes [BR:wsu01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     WS0157 (ACCD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(160381..161250)
Genome map
AA seq 289 aa AA seqDB search
MGFADFFKTFTRERAKEGESPSHWIKCPSCSALMYYKEVIAQHHVCPKCNFHMRIALEDR
IEMLCDEGTLIEHDASLEPTDPLTFVDKKSYKKRIEEGKQKTGRASSVLSGECRINGVST
QIVLFNFAFMGGSLGSVEGEKIVRAVNRALEKHQGLVILSTSGGARMQESTYSLMQMAKT
SAALARLSQAKLPFISLLTDPTMGGVSASFAFLGDIIIAEPGAMVGFAGARVIKQTIGAD
LPEGFQTAEFLLEHGLIDMITPRKEMKKTLGDLLRFFNPYDENPCLLHL
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgggttttgccgacttttttaaaaccttcactagagaacgcgccaaagagggggaatcc
cctagtcactggatcaaatgccctagttgtagcgccctcatgtattacaaggaggtgatc
gcgcaacatcatgtctgccctaagtgcaacttccatatgcgcatcgccctcgaagatcgc
attgagatgctctgcgatgaggggactctcattgagcacgacgcctccctagagcccact
gatccgctcacttttgtagacaagaagagctacaaaaaaagaatcgaagagggaaaacaa
aaaacagggcgcgccagctctgttctaagcggagagtgtcgaatcaatggggttagcacc
caaatcgtgctctttaactttgcttttatgggaggaagccttggctcggtggagggtgaa
aaaatcgttcgcgcggtcaatcgtgccctcgaaaaacaccaaggactcgtgattctcagc
actagcggaggcgctagaatgcaagagagcacctactctttgatgcagatggccaagaca
agcgcggctttggcgcgactctctcaggccaagcttccttttatctctctcctcactgat
cctaccatggggggcgtgagcgcctcttttgcctttttgggcgatatcattatcgccgaa
cccggagccatggtaggctttgctggagcgagggtcatcaaacagaccattggagcggat
ctgcctgagggcttccaaacggcggaatttttgcttgagcatgggctcattgacatgatc
accccacgcaaggagatgaagaagaccttgggcgaccttttgagattcttcaacccctac
gatgaaaatccgtgtctattgcatctctaa

DBGET integrated database retrieval system