KEGG   Wolinella succinogenes: WS0188Help
Entry
WS0188            CDS       T00146                                 

Definition
(GenBank) GUANYLATE KINASE
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00230  Purine metabolism
wsu01100  Metabolic pathways
Module
wsu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    WS0188
Enzymes [BR:wsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     WS0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 ABC_tran AAA_16 AAA_22 MMR_HSR1 AAA_33 Thymidylate_kin AAA RsgA_GTPase Cytidylate_kin RNA_helicase T2SSE CPT KAP_NTPase Rad17 AAA_5 AAA_29 AAA_17 AAA_14 ATPase_2 Gtr1_RagA DUF815 AAA_PrkA AAA_24 MobB NTPase_1 TsaE NACHT AAA_28 APS_kinase
Motif
Other DBs
NCBI-ProteinID: CAE09349
UniProt: Q7MAK5
Position
complement(190668..191315)
Genome map
AA seq 215 aa AA seqDB search
MERSKGAILVLSGPSGSGKSSLCKTLFKEIKNAYFSVSTTTRTPREGEIEGKHYHFVSKE
KFLEGIEENFFLEWAEVHGNYYGTSKESVESALAQGKLVVFDIDIQGHRNIKESYPELTT
SVFITTPTQQELRERLVLRGTDDKETIDLRVMHAYTEMKHIKEFDFVIVNRDLKESEKLL
LSIARAALSKRILYDVESLVARWKSKETPKTPNSQ
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgatctaaaggcgcaattcttgttctctctgggcctagcggctcagggaaaagc
tctctatgcaaaaccctattcaaagagattaaaaacgcttacttttccgtctccaccacc
acgcgcactcctcgtgaaggcgaaatcgaaggcaagcattaccattttgtttccaaggag
aagttcctagagggaatcgaggagaattttttcctagagtgggctgaagtccatggcaat
tactatggcacctccaaagaatccgtcgaatcggctttggctcaaggaaaattggtggtc
tttgatattgatattcaaggacaccgcaacatcaaagaatcttatcccgagctcaccacc
tctgtcttcatcaccacacccacccagcaagagctcagagagcgtctcgtgctccgagga
accgacgataaagagacgattgatcttcgcgtgatgcacgcctacacggagatgaaacac
atcaaagagtttgactttgtgatcgtcaacagagacctcaaagaatcagaaaagcttctc
ctctccatcgccagagcagctctctctaaaagaattctctacgatgtagaaagccttgta
gcccgctggaaaagcaaagagactcctaagactcctaacagtcaatag

DBGET integrated database retrieval system