KEGG   Wolinella succinogenes: WS0340Help
Entry
WS0340            CDS       T00146                                 

Gene name
GALU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
wsu  Wolinella succinogenes
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    WS0340 (GALU)
   00052 Galactose metabolism
    WS0340 (GALU)
   00500 Starch and sucrose metabolism
    WS0340 (GALU)
   00520 Amino sugar and nucleotide sugar metabolism
    WS0340 (GALU)
Enzymes [BR:wsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     WS0340 (GALU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
336895..337722
Genome map
AA seq 275 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPIVNKPLIQYGVEEALEAGITTMAIVTGRGKR
SLEDHFDISYELEHQIRGTDKEIYLKDIREVMEQCTFSYTRQMEMKGLGHAILTGETLIG
NEPFAVVLADDLCDNPEGEGVLSQMIELYHKYRCSIVAIEEVEVSEVDKYGVISGREIDA
GVYMVDNMIEKPSIAEAPSNLAVIGRYILTPDIFDILRDTKPGKKGEIQITDALLEQCKK
GMVLAYKFKGKRYDCGSIDGFVMATNVFYQKHHQG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaagtgcctctttcccgctgcaggctatgggacgcgattcttgcctgcaacc
aaggcgatgcccaaagagatgcttcctattgtgaataaaccgctcattcagtatggagtc
gaagaggcgttagaggctggaatcaccaccatggcgattgtcacgggtcgaggcaagcga
tctttagaggatcactttgatattagctatgagctagagcatcagattcgagggacggat
aaggagatttatctcaaagatattcgagaggtgatggagcagtgcaccttctcttatacg
cgccaaatggagatgaagggcttgggacatgcgatcctcacgggagagacactcattggc
aatgagccttttgctgttgttttggcggatgatctatgcgacaatccagagggtgaaggg
gtgctttcacagatgattgaactctatcacaaataccgctgctctatcgttgccatcgaa
gaggtggaggtgagcgaggtggacaaatatggggtgattagtggacgagagattgatgcg
ggtgtctatatggtggataatatgatcgaaaagccctctatagctgaggctcctagcaat
ctagccgtcattgggcgttatattctcactcctgatatttttgatattttgcgcgataca
aagccgggaaaaaaaggggagattcagatcaccgatgcgctcttggagcagtgcaaaaag
gggatggtgctcgcctataaattcaaagggaaacggtatgattgtgggagtattgatggc
tttgtgatggcgaccaatgtcttttatcaaaaacaccaccaagggtag

DBGET integrated database retrieval system