KEGG   Wolinella succinogenes: WS0424Help
Entry
WS0424            CDS       T00146                                 

Gene name
TPIA
Definition
(GenBank) TRIOSEPHOSPHATE ISOMERASE TIM
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00010  Glycolysis / Gluconeogenesis
wsu00051  Fructose and mannose metabolism
wsu00562  Inositol phosphate metabolism
wsu01100  Metabolic pathways
wsu01110  Biosynthesis of secondary metabolites
wsu01120  Microbial metabolism in diverse environments
wsu01130  Biosynthesis of antibiotics
wsu01200  Carbon metabolism
wsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS0424 (TPIA)
   00051 Fructose and mannose metabolism
    WS0424 (TPIA)
   00562 Inositol phosphate metabolism
    WS0424 (TPIA)
Enzymes [BR:wsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WS0424 (TPIA)
Exosome [BR:wsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WS0424 (TPIA)
  Exosomal proteins of bladder cancer cells
   WS0424 (TPIA)
  Exosomal proteins of melanoma cells
   WS0424 (TPIA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAE09568
UniProt: Q7MA77
Position
complement(419094..419792)
Genome map
AA seq 232 aa AA seqDB search
MILAANFKTNHTRKSTRHYLERLSNFLFETSCEHDIFLFPPPLALDFFDDIGGVCIGTQN
AYPAPSGAFTGEVGSEQLEELAIQTILIGHSERRGILGESQAFCAEKFRYYASLGYTIFY
CIGESLEVRRAGIEATIRHNLSQLEGIDLSYPKLIIAYEPIWAIGTGVSASLEQIQETHA
ALKAHLSCPLLYGGSVNLSNIAEILALPEVDGALIGSASLKVEDFCQMIQKI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattttagccgccaatttcaaaacaaatcacacgcgaaaatcgactcgacactatcta
gagcgtctctccaatttcctctttgagacaagttgcgagcatgatatttttctcttcccg
cctcccttggccctcgattttttcgatgatattggaggggtttgcattggaacacaaaac
gcctaccccgcaccaagtggagccttcacgggcgaagtaggaagcgagcaattagaagag
ctggctatccaaacgatccttatcgggcatagcgaacgaagaggaatcctaggagaatcc
caagccttctgtgcagaaaaatttcgctactacgcctccttgggctacacgatcttttac
tgcatcggcgagagcctagaggtgagaagggcaggaatcgaggcaacgattcgtcacaat
ctctcccagctagagggaatcgatctctcctatcccaagctcatcatagcctatgagccc
atttgggcgattggcacgggagtgagcgcctccttagagcagatccaagagacccacgcc
gctctcaaagcgcatctctcttgccctctcctttatggcggaagcgtgaatctctccaat
atcgccgagattctcgctctccctgaagtcgatggcgcgctcattggaagcgcttcgctc
aaagtggaagatttttgccaaatgattcaaaaaatttaa

DBGET integrated database retrieval system