KEGG   Wolinella succinogenes: WS0424Help
Entry
WS0424            CDS       T00146                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wsu  Wolinella succinogenes
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WS0424 (tpiA)
   01230 Biosynthesis of amino acids
    WS0424 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS0424 (tpiA)
   00051 Fructose and mannose metabolism
    WS0424 (tpiA)
   00562 Inositol phosphate metabolism
    WS0424 (tpiA)
Enzymes [BR:wsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WS0424 (tpiA)
Exosome [BR:wsu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WS0424 (tpiA)
  Exosomal proteins of bladder cancer cells
   WS0424 (tpiA)
  Exosomal proteins of melanoma cells
   WS0424 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(419094..419792)
Genome map
AA seq 232 aa AA seqDB search
MILAANFKTNHTRKSTRHYLERLSNFLFETSCEHDIFLFPPPLALDFFDDIGGVCIGTQN
AYPAPSGAFTGEVGSEQLEELAIQTILIGHSERRGILGESQAFCAEKFRYYASLGYTIFY
CIGESLEVRRAGIEATIRHNLSQLEGIDLSYPKLIIAYEPIWAIGTGVSASLEQIQETHA
ALKAHLSCPLLYGGSVNLSNIAEILALPEVDGALIGSASLKVEDFCQMIQKI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgattttagccgccaatttcaaaacaaatcacacgcgaaaatcgactcgacactatcta
gagcgtctctccaatttcctctttgagacaagttgcgagcatgatatttttctcttcccg
cctcccttggccctcgattttttcgatgatattggaggggtttgcattggaacacaaaac
gcctaccccgcaccaagtggagccttcacgggcgaagtaggaagcgagcaattagaagag
ctggctatccaaacgatccttatcgggcatagcgaacgaagaggaatcctaggagaatcc
caagccttctgtgcagaaaaatttcgctactacgcctccttgggctacacgatcttttac
tgcatcggcgagagcctagaggtgagaagggcaggaatcgaggcaacgattcgtcacaat
ctctcccagctagagggaatcgatctctcctatcccaagctcatcatagcctatgagccc
atttgggcgattggcacgggagtgagcgcctccttagagcagatccaagagacccacgcc
gctctcaaagcgcatctctcttgccctctcctttatggcggaagcgtgaatctctccaat
atcgccgagattctcgctctccctgaagtcgatggcgcgctcattggaagcgcttcgctc
aaagtggaagatttttgccaaatgattcaaaaaatttaa

DBGET integrated database retrieval system