KEGG   Wolinella succinogenes: WS0440Help
Entry
WS0440            CDS       T00146                                 

Gene name
RUVA
Definition
(GenBank) PUTATIVE HOLLIDAY JUNCTION DNA HELICASE
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
wsu  Wolinella succinogenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WS0440 (RUVA)
Enzymes [BR:wsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     WS0440 (RUVA)
DNA repair and recombination proteins [BR:wsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     WS0440 (RUVA)
    RecFOR pathway proteins
     WS0440 (RUVA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(435499..436068)
Genome map
AA seq 189 aa AA seqDB search
MIVALKGNIEKKEPTRLWLEVGGVTYEIFISIHTSAALGEKEARLLITHLIREEAWSLYG
FAEEAEKRVFDTLIKINGVGPKAALAILSTYTPPTFAQIIQAQDVKALQRVPGIGPKSAG
RIMVELAGFSLSLQEGSKASTPPVFEESRLALESLGFKSELIAKALQNIQATTTQEIIKE
ALKKLQTLR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgtcgcactcaaaggaaatattgaaaaaaaagagcccacgaggctctggcttgaa
gtggggggtgtgacctatgagattttcatctccattcacaccagcgctgctttgggtgaa
aaagaggcaagactcctcatcacccacctcatccgcgaggaggcttggtcgctctatgga
tttgccgaggaggcagagaagagagtttttgacactcttatcaagattaatggagtgggt
cctaaggcagccttagcgattctctccacctacactccccccacctttgctcaaatcatc
caagctcaagacgtgaaagccctccagcgcgttccagggattgggcccaagagtgcggga
agaatcatggtcgagcttgcaggtttctccctctcgctccaagagggttccaaagcctcc
acgcctcctgtttttgaagaatcaaggctcgcgcttgaatcacttggctttaagagcgag
ctcatcgccaaagccctccaaaacatccaagccaccacaactcaagagatcatcaaagag
gccctcaaaaagctccagaccctccgctaa

DBGET integrated database retrieval system