KEGG   Wolinella succinogenes: WS0440Help
Entry
WS0440            CDS       T00146                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
wsu  Wolinella succinogenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WS0440 (ruvA)
Enzymes [BR:wsu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     WS0440 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(435499..436068)
Genome map
AA seq 189 aa AA seqDB search
MIVALKGNIEKKEPTRLWLEVGGVTYEIFISIHTSAALGEKEARLLITHLIREEAWSLYG
FAEEAEKRVFDTLIKINGVGPKAALAILSTYTPPTFAQIIQAQDVKALQRVPGIGPKSAG
RIMVELAGFSLSLQEGSKASTPPVFEESRLALESLGFKSELIAKALQNIQATTTQEIIKE
ALKKLQTLR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgtcgcactcaaaggaaatattgaaaaaaaagagcccacgaggctctggcttgaa
gtggggggtgtgacctatgagattttcatctccattcacaccagcgctgctttgggtgaa
aaagaggcaagactcctcatcacccacctcatccgcgaggaggcttggtcgctctatgga
tttgccgaggaggcagagaagagagtttttgacactcttatcaagattaatggagtgggt
cctaaggcagccttagcgattctctccacctacactccccccacctttgctcaaatcatc
caagctcaagacgtgaaagccctccagcgcgttccagggattgggcccaagagtgcggga
agaatcatggtcgagcttgcaggtttctccctctcgctccaagagggttccaaagcctcc
acgcctcctgtttttgaagaatcaaggctcgcgcttgaatcacttggctttaagagcgag
ctcatcgccaaagccctccaaaacatccaagccaccacaactcaagagatcatcaaagag
gccctcaaaaagctccagaccctccgctaa

DBGET integrated database retrieval system