KEGG   Wolinella succinogenes: WS0497Help
Entry
WS0497            CDS       T00146                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
wsu  Wolinella succinogenes
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    WS0497
Enzymes [BR:wsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     WS0497
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498304..498918
Genome map
AA seq 204 aa AA seqDB search
MDKKLAQEMGRISLSMFRKNFFGVFHGSISAKLGDNRFVINKKDAIFDEINEESLITLYH
SRDYRWQEASIDSFIHSNIYQNISDAKYIAYCLPPFTMAYALRFNKIVPQDYFGATLFKV
IEVYNPRDFETWYERADVEIYRHMKEKRVKAMVIRGYGVYLFDRDINHLAKTIAVIENSC
RILYLSATLGGVPGVQSCDLPYTI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaattagcgcaagagatggggcgaatctccctctccatgtttcggaaaaac
ttctttggagtctttcacggctcgatctctgccaagcttggcgacaatcgatttgttatc
aacaaaaaagatgcgatttttgatgagatcaacgaagaatcactcatcaccctctaccac
tcccgtgactatcgctggcaagaggcgagcatcgattcgttcattcattccaatatctat
caaaacatcagcgacgctaaatatatcgcctactgcttaccgcctttcacgatggcttat
gcactacgcttcaataaaattgtcccacaggattactttggagctaccctttttaaggtg
atcgaggtttataatcctagggattttgagacttggtatgaacgagcggatgtagagatc
tatcgccacatgaaagagaagagggttaaggcgatggtgattcgagggtatggggtctat
ctttttgatcgtgacattaatcatcttgccaagaccattgcggtgattgaaaatagctgt
cggattctctatctctctgctaccctggggggcgtcccaggagtgcagagttgtgatctt
ccctatactatttag

DBGET integrated database retrieval system