KEGG   Wolinella succinogenes: WS0506Help
Entry
WS0506            CDS       T00146                                 

Gene name
PROB
Definition
(GenBank) PUTATIVE GAMMA-GLUTAMYL KINASE
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00330  Arginine and proline metabolism
wsu00332  Carbapenem biosynthesis
wsu01100  Metabolic pathways
wsu01130  Biosynthesis of antibiotics
wsu01230  Biosynthesis of amino acids
Module
wsu_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    WS0506 (PROB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    WS0506 (PROB)
Enzymes [BR:wsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     WS0506 (PROB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: CAE09643
UniProt: Q7MA27
Position
504633..505418
Genome map
AA seq 261 aa AA seqDB search
MRRIVIKVGSALLSRGHEMAMDRMESLCRFIAELKQKGDEVILVTSAAVAAGYTALALDK
RQLPNRQALAAIGQPLLMNLYHQTLAPLGILPAQMLLSAYDFDSRKRTENARNTIEVLLS
HGVLPIINENDAVATKELDMLAVFGDNDRLSAHVAHYFSAEILLILSDIDGYYDKNPCEF
PDAKIRRVVNFLTPEELEAEVSPNNAFATGGIVTKLQAADFLMKRGQKMFLANGFNLGDA
RSFLLEGIHCQGTLFVQGGES
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgaattgtcatcaaggtcggaagcgcgcttttaagccgagggcatgagatggca
atggatcggatggagtcgctctgtcgttttatcgcggagttgaagcaaaaaggcgatgag
gtgattttggtcacttcggccgcggtagcagcgggatacacagcactggcgttggataag
agacaattgcccaatcgtcaggcgcttgctgccattggccagccacttctcatgaatctc
tatcatcaaacgctagcccccttgggaatcttgcccgctcaaatgctcctctctgcctat
gattttgattcgcgaaagcgaacagaaaatgcacgcaacacgattgaggtgctgctgagt
catggcgttttgcccatcatcaatgagaatgacgcggttgccaccaaggagcttgatatg
ctcgcggtctttggcgacaacgatcgactctcggctcatgtagcgcactattttagcgcc
gagattcttctgattttgagtgacattgatggctattatgataagaatccttgtgaattt
cctgatgccaagatcaggcgtgtggtcaattttttgacacccgaggagctggaggcggag
gtttcacccaataacgcttttgccacagggggaattgtcaccaagcttcaagcggcggat
tttctcatgaagcgagggcagaaaatgtttctggccaatggcttcaatctaggggatgcg
cgaagctttctcttggagggaatccattgccaagggacgctatttgtgcaaggaggagaa
tcgtga

DBGET integrated database retrieval system