KEGG   Wolinella succinogenes: WS0588Help
Entry
WS0588            CDS       T00146                                 

Definition
(GenBank) DESUCCINYLASE
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00300  Lysine biosynthesis
wsu01100  Metabolic pathways
wsu01120  Microbial metabolism in diverse environments
wsu01230  Biosynthesis of amino acids
Module
wsu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    WS0588
Enzymes [BR:wsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     WS0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CAE09720
UniProt: Q7MSC2
Position
574319..575413
Genome map
AA seq 364 aa AA seqDB search
MKPSVIEILQKLLTYPSITPKECGIFDYVRSLLEGFEAIEVEHEGVKNLLLYRCFGEGEH
WCLAGHIDVVPPGEGWSVDPFGAELKEGYLYGRGAQDMKSGVAAMISALAKIDHFPGTLS
LLLTSDEEGEAKWGTQLMLEHLKERGFLPKVAIVTEPTSEERFGDTIKVGRRGSINGKLI
IHGKQGHVAYPSKCLNPVELIAPRLAQIAGYNLDAGDEFFEPSKLVITDIRGGIEAVNVT
PSDLKILFNVRHSTQTSAKEIEDYLHQLLQGIPYTLEIKPSSKPFLTSRESVVVKRVSEA
VKRVMGVAPKLSTGGGTSDARYFAQFGVEVVECGVVNDRIHALDERVALLEVEALERVLL
EALG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccttctgttattgagattctccaaaagctcctcacctacccctccatcactccc
aaagagtgcggaatctttgattatgtgcgctcgctcctagagggctttgaggcgattgag
gtcgaacatgagggggtgaagaatctcctcctctatcgctgttttggcgagggggagcac
tggtgtttggcggggcatattgatgtggtgcctccgggcgaggggtggagcgtggatcct
tttggagcggagcttaaagaggggtatctctatgggcggggcgctcaggatatgaaaagc
ggcgtggcggcgatgattagcgccctagctaaaatcgaccatttccccggaacgctctcc
ttgcttctcactagcgatgaggagggagaggcaaagtggggaacgcaattgatgctagag
cacctcaaagagagaggattcttacccaaggtggctatcgttacagagcccacgagcgaa
gagcgttttggtgacaccattaaggtggggcggagagggtctatcaatggaaagctgatc
atccatgggaagcagggtcatgtggcctatccaagcaagtgtctcaaccccgtggagctc
atcgccccaaggttagcgcaaatcgctggatacaatcttgatgctggggatgagtttttt
gagccaagtaagctcgtcattaccgatattcgtggaggaatcgaggcggtgaatgtcacg
cctagcgatcttaaaatcctctttaatgtgcgccattcgactcaaacctcggccaaagag
atagaggactacctgcatcaactcctccaaggaatcccctatacgcttgagatcaagcca
agctccaagccttttttgacctcaagagagagtgtcgtggtgaagcgtgtgagcgaggcg
gtcaaaagggtgatgggagtcgctcccaagctctccacggggggcgggacgagcgatgcg
cgatattttgcacaatttggagtcgaagtggtggagtgcggggtggtcaatgatcgaatc
catgccttggatgagcgtgtggccctcttggaggttgaggcgctagagagggtgcttttg
gaggcgctcgggtag

DBGET integrated database retrieval system