KEGG   Wolinella succinogenes: WS0699Help
Entry
WS0699            CDS       T00146                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
wsu  Wolinella succinogenes
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WS0699 (recR)
DNA repair and recombination proteins [BR:wsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      WS0699 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669457..670029
Genome map
AA seq 190 aa AA seqDB search
MKKGMESFFTLVESLEKLPSVGRKSALRLGYFLAIEEKFSALKLAHAIEEAVVKIKRCER
CGALSEHELCEICSDETRLNGQLCIVTHPKDIFILEESKHFEGRYFVIDSLEDCDFTLLR
SLIVSLKITEVIFAFSPSLSNDSIIFYVEDKLQDLGVSFSKIAQGVPTGVSLENIDQLSL
TRAFDSRIKL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggaatggaatcattttttacactagtggaatcgctagaaaagctcccctct
gtagggcgtaaatcggcgcttcgtctgggctattttttggctattgaggagaagttctcc
gcgcttaagctcgcgcacgccattgaagaggcggtggtgaagatcaagcgttgtgagcgt
tgtggagcgctgagtgagcatgagctttgcgagatttgtagcgatgagacgcggcttaat
ggacaactctgtattgtcactcaccccaaagacatcttcatccttgaagaatcaaagcac
ttcgaggggcgctatttcgtgatcgattctctggaggattgcgatttcactctgcttcga
tcactcatcgtctctcttaaaatcaccgaggtcatctttgccttctccccctcactctct
aatgattcgatcattttttatgttgaggataaacttcaggatttgggggtctctttctct
aagatcgcccaaggagttcctacaggggtgagcttggagaatattgatcaactctcgcta
actagagcatttgactcaagaatcaagctctag

DBGET integrated database retrieval system