KEGG   Wolinella succinogenes: WS0719Help
Entry
WS0719            CDS       T00146                                 

Gene name
trpB
Definition
(GenBank) PUTATIVE TRYPTOPHAN SYNTHASE (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
wsu  Wolinella succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WS0719 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WS0719 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    WS0719 (trpB)
Enzymes [BR:wsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     WS0719 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
685970..687181
Genome map
AA seq 403 aa AA seqDB search
MMHKPYLKSFPNKEGYFGKYGGAYLPPLLIEHFKEIGEAYLKISQSFDFIQELKSIRKHY
QGRPTPLYYARRLSQKAGGAAIYLKREDLNHTGAHKLNHCMAEALLAKHLGKKKLIAETG
AGQHGVALATAAAYFGMECEIHMGEVDIAKEHPNVIRMKMLGAKVVPVSFGERTLKEAVD
SAFEAYLKDPANAIYAIGSVVGPHPFPKMVRDFQSVVGAEAKEQFLEMTGELPDHIVACV
GGGSNAMGIFSAFIDDPVELWGVEPLGKGKSLGEHAASLSYGKEGVMHGFNSIMLQNEDG
SPASVHSVASGLDYPSVGPEHAYLHEIGRTHSVGVSDEEAIKNFFALSRLEGIIPAIESA
HAIAYGMKLAKERLGEKILINLSGRGDKDIDYVSETFGFGGEE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacaaaccctacctcaagagctttcccaataaagagggatattttggcaaatat
ggcggcgcttacttgcctcctttgctcattgaacacttcaaagagattggagaggcctac
ctcaaaatctcccagagttttgattttatccaagagctaaaaagtatccgcaagcactac
caagggcgacccacacccctctattacgcgcggagattgagtcaaaaagcaggaggcgca
gcgatctatcttaagcgtgaagacctcaatcacacgggggcacataagctcaatcattgt
atggcggaggctctattggctaagcatctaggcaaaaagaagctgattgctgagacaggc
gcagggcagcatggcgtagcgcttgcgactgccgcagcctactttggcatggagtgcgag
attcacatgggagaggtggacattgccaaggaacaccccaatgtgattcgcatgaagatg
ctaggggcaaaggtggtgcccgtgagttttggcgaaaggacactcaaggaggcggtggat
agcgcttttgaggcctatctcaaagaccctgcgaatgcgatctatgcgattggctcggtg
gtgggacctcaccccttccctaaaatggttcgtgacttccaaagtgttgtgggcgcagag
gcgaaagagcagtttttggagatgacgggcgagctccccgatcatatcgtggcgtgcgtg
ggaggcggaagcaatgcgatgggaatctttagcgcctttattgatgatcccgtggaacta
tggggagtggagcctctaggtaaaggaaaaagcctaggcgagcacgccgcgagtcttagc
tatggcaaagagggggtgatgcatggatttaactccattatgcttcaaaacgaggatggc
tctcccgcctcagttcactccgtggcgagtggacttgactacccctcggtggggccagag
cacgcctatttgcatgagattggcaggacgcactccgtgggcgtgagcgatgaagaggcg
atcaagaacttctttgccctctcacgcctagagggaatcattcccgccattgagagtgcc
catgcgatcgcctatggcatgaagctcgccaaagagcgcttgggtgagaagattctcatc
aatctcagtggtcgtggggataaggatattgattatgtttcagagacatttggttttgga
ggcgaggaatga

DBGET integrated database retrieval system