KEGG   Wolinella succinogenes: WS0719Help
Entry
WS0719            CDS       T00146                                 

Gene name
trpB
Definition
(GenBank) PUTATIVE TRYPTOPHAN SYNTHASE
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00260  Glycine, serine and threonine metabolism
wsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
wsu01100  Metabolic pathways
wsu01110  Biosynthesis of secondary metabolites
wsu01130  Biosynthesis of antibiotics
wsu01230  Biosynthesis of amino acids
Module
wsu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WS0719 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    WS0719 (trpB)
Enzymes [BR:wsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     WS0719 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAE09842
UniProt: Q7M9S1
Position
685970..687181
Genome map
AA seq 403 aa AA seqDB search
MMHKPYLKSFPNKEGYFGKYGGAYLPPLLIEHFKEIGEAYLKISQSFDFIQELKSIRKHY
QGRPTPLYYARRLSQKAGGAAIYLKREDLNHTGAHKLNHCMAEALLAKHLGKKKLIAETG
AGQHGVALATAAAYFGMECEIHMGEVDIAKEHPNVIRMKMLGAKVVPVSFGERTLKEAVD
SAFEAYLKDPANAIYAIGSVVGPHPFPKMVRDFQSVVGAEAKEQFLEMTGELPDHIVACV
GGGSNAMGIFSAFIDDPVELWGVEPLGKGKSLGEHAASLSYGKEGVMHGFNSIMLQNEDG
SPASVHSVASGLDYPSVGPEHAYLHEIGRTHSVGVSDEEAIKNFFALSRLEGIIPAIESA
HAIAYGMKLAKERLGEKILINLSGRGDKDIDYVSETFGFGGEE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgatgcacaaaccctacctcaagagctttcccaataaagagggatattttggcaaatat
ggcggcgcttacttgcctcctttgctcattgaacacttcaaagagattggagaggcctac
ctcaaaatctcccagagttttgattttatccaagagctaaaaagtatccgcaagcactac
caagggcgacccacacccctctattacgcgcggagattgagtcaaaaagcaggaggcgca
gcgatctatcttaagcgtgaagacctcaatcacacgggggcacataagctcaatcattgt
atggcggaggctctattggctaagcatctaggcaaaaagaagctgattgctgagacaggc
gcagggcagcatggcgtagcgcttgcgactgccgcagcctactttggcatggagtgcgag
attcacatgggagaggtggacattgccaaggaacaccccaatgtgattcgcatgaagatg
ctaggggcaaaggtggtgcccgtgagttttggcgaaaggacactcaaggaggcggtggat
agcgcttttgaggcctatctcaaagaccctgcgaatgcgatctatgcgattggctcggtg
gtgggacctcaccccttccctaaaatggttcgtgacttccaaagtgttgtgggcgcagag
gcgaaagagcagtttttggagatgacgggcgagctccccgatcatatcgtggcgtgcgtg
ggaggcggaagcaatgcgatgggaatctttagcgcctttattgatgatcccgtggaacta
tggggagtggagcctctaggtaaaggaaaaagcctaggcgagcacgccgcgagtcttagc
tatggcaaagagggggtgatgcatggatttaactccattatgcttcaaaacgaggatggc
tctcccgcctcagttcactccgtggcgagtggacttgactacccctcggtggggccagag
cacgcctatttgcatgagattggcaggacgcactccgtgggcgtgagcgatgaagaggcg
atcaagaacttctttgccctctcacgcctagagggaatcattcccgccattgagagtgcc
catgcgatcgcctatggcatgaagctcgccaaagagcgcttgggtgagaagattctcatc
aatctcagtggtcgtggggataaggatattgattatgtttcagagacatttggttttgga
ggcgaggaatga

DBGET integrated database retrieval system