KEGG   Wolinella succinogenes: WS0812Help
Entry
WS0812            CDS       T00146                                 

Definition
(GenBank) 1-DEOXY-D-XYLULOSE 5-PHOSPHATE REDUCTOISOMERASE
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00900  Terpenoid backbone biosynthesis
wsu01100  Metabolic pathways
wsu01110  Biosynthesis of secondary metabolites
wsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WS0812
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     WS0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-ProteinID: CAE09925
UniProt: Q7M9M7
Position
complement(768529..769605)
Genome map
AA seq 358 aa AA seqDB search
MILLGSTGSIGQNALSLARDFRLPVEVLVAGHNLSLLNAQIAEFQPKIIVIADSSRASEL
SLPKDSKLLFGEEGIIESLHLAQSSFVLNALVGFLGLRPTLESLRLGKTLALANKESLVA
GGSFVDASKIIPVDSEHFSLWFLKSDKPFSRLFITASGGAFRDTPLEEIPLQKAQAALRH
PNWSMGRKITVDSATMVNKLFEILEARWLFNTKSVDALIERNSLVHALIGYPDGSFSAHI
AQADMRLPLAYAMLGKLDQPLGPPLELERLAALSFEPINPSRYPLWNLKEKLLTHPWLGI
TLNAANEVAVEKFLEGKILFGEIPRYIERSLERFSMIPASIEELFALDSEVRQFAHKL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
ttgattcttcttggctccacaggttcgattggccaaaatgccctctcccttgcccgcgac
tttcgtctccctgtagaggttttagtcgcaggtcacaatctctccctgctcaatgcccaa
atcgctgaatttcagcccaagatcatcgtcattgccgattcctctagggcaagtgagctc
tccttgcccaaagattcgaagctcctctttggcgaggagggaatcatcgaatcgctccac
ctcgcccaatcctctttcgtgctcaacgctcttgtgggattccttggacttcgccccacc
ctagagagccttcgccttggaaaaaccctcgcgctcgccaataaagaatcgctagtggcg
gggggctcttttgtggatgcctcaaagatcatccccgtggatagcgaacacttcagcctc
tggtttttaaagagcgacaaacccttttctcgcctcttcatcaccgcaagcgggggagct
tttcgcgatactcctttagaggagattcccctccaaaaagcccaagccgccctccgccat
cccaactggagcatggggcgcaaaatcaccgtggatagcgccacgatggtcaacaaactc
tttgagattctcgaagctagatggctctttaacaccaagagcgtggacgccctaattgag
agaaactctctcgtccatgcactcattggttaccctgatggaagctttagcgcccacatc
gctcaagcggatatgcgactaccccttgcctatgccatgcttggcaagcttgatcagcct
cttggccctccgctagagttagagcgcctcgccgccctctcctttgagcctatcaatccc
tcgcgctaccccttgtggaatctcaaagagaagcttttgacgcatccatggcttggaatc
acgctcaatgcagccaacgaagtggcggtggagaaattcttagaggggaagattctcttt
ggagagattcctcgttacatagagcgctctttggagcgattttcgatgattcctgcctct
atcgaggagctatttgctcttgattctgaggttcggcaattcgcgcataagctttga

DBGET integrated database retrieval system