KEGG   Wolinella succinogenes: WS0843Help
Entry
WS0843            CDS       T00146                                 

Definition
(GenBank) PUTATIVE SIGNAL TRANSDUCTION PROTEIN
  KO
K03406  
methyl-accepting chemotaxis protein
Organism
wsu  Wolinella succinogenes
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WS0843
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    WS0843
Bacterial motility proteins [BR:wsu02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    WS0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
798976..800661
Genome map
AA seq 561 aa AA seqDB search
MGWIQDWKVRTKIVVIVTVFALVAGGIGWRGLSGADLLNSSITTIVQVNVPRIAESQSLL
VNLLQLQRTEKNHILSESQEQLEQRERNYRKKEEEIAKQLKLLEGLVSEQNRIKVKECAE
SFKKYSQTVEKVLELSRAGMNDQATKISQNEARIHMDRCEELMEQIVASNEENLSITDKE
TNELYEGMRYSILVIIIVGLAIAFLMSMLVIKNITHALALVKSGLLSFFSFLSRESKEAQ
LINLSSKDEFGEMAGAINENIKRIQKGLLEDTETVQETLMVVNRIKEGHLNQAIHSLPDN
PQLLKLKELLNEMLASLNQNFQGVLSLLKSYAENDFRERMEKGGLKGEVASLIEGVNYLG
GEITKMLQSSLDSGHSMEKQARLLQESMEVLSQGANEQAASLEESAAAIEEMSSSMGGIS
HRAEEVSKQTEEIRNVIMIIRDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRKLAE
RTQKSLGEIEANTNVLVQSVNEMSDSIKEQAQGITQINEAIAQLDTVTQQNAGVADKTDG
IAREVSKMAEGMVEEVRKKRF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgggatggattcaagattggaaagtgagaacaaaaatcgtcgttattgtaacggttttt
gcgctggtggcggggggtattggctggcgggggttatcaggggcggatcttttgaatagc
tctatcacgaccattgtgcaggtgaatgttccaaggatagccgaatcgcaatccttgctg
gttaatctgctgcaactccaaagaacagagaagaatcatatcctctctgagagccaagag
cagctagagcagcgtgagagaaactatcgcaaaaaagaggaagagatcgccaagcaacta
aagcttttagagggattggtgagtgagcagaatcggataaaagtcaaagagtgcgccgag
tcattcaaaaaatatagccagaccgtcgagaaggtcttggagctctcaagggcggggatg
aacgatcaagcgaccaaaatttctcaaaatgaagccagaatccacatggatagatgcgag
gagctcatggagcagattgtcgcctctaacgaggagaatctctccatcaccgacaaagag
accaatgagctctatgaggggatgaggtatagcattttggtgatcatcatcgtggggttg
gcgattgcctttttaatgtcaatgcttgtgattaaaaatatcactcacgcactcgcccta
gtcaaatccggcctcctctccttcttctctttcctctcaagagaatccaaagaggcacag
ctcatcaatctctcctctaaagatgagtttggagagatggctggagcgatcaatgaaaac
atcaagcgtatccaaaaagggttgctagaggacacagagaccgtccaagagactcttatg
gtggtcaatagaatcaaagagggtcatctcaaccaagccatccactccctccctgataat
cctcagctcctcaaactcaaagagcttcttaatgagatgcttgcctctttgaatcaaaac
ttccaaggagtcctctctcttctaaagagctacgctgagaatgactttagggagaggatg
gaaaaaggaggactcaaaggagaagtcgcctctttgattgaaggggtcaactatctagga
ggagagatcactaagatgctccaaagctctcttgattcaggacactccatggagaaacag
gccagactcctgcaagaatcaatggaggttctctctcagggagccaacgaacaagccgcc
agcctagaagagagtgccgccgctattgaagagatgagtagctctatgggaggaatcagc
catagagctgaagaggtctctaaacagactgaagagattcgtaatgtcatcatgatcatt
agagacattgccgatcaaaccaatctactggctctaaatgctgccattgaagccgcaaga
gcaggagagcatggaagaggatttgcagtcgttgccgatgaagtgagaaagctagcggag
agaactcagaagtctttaggagagatagaggccaataccaatgtcctagttcaatctgtc
aatgagatgagtgatagtattaaagagcaagctcaaggaatcactcagatcaatgaagcc
attgcccaacttgatactgtaacccaacaaaatgcaggagtagcggataagacggatggg
atagctagagaggtctctaagatggcagaggggatggttgaagaggtgaggaagaagagg
ttttaa

DBGET integrated database retrieval system