KEGG   Wolinella succinogenes: WS0914Help
Entry
WS0914            CDS       T00146                                 

Gene name
NOSZ
Definition
(GenBank) NITROUS OXIDE REDUCTASE SUBUNIT
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00910  Nitrogen metabolism
wsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    WS0914 (NOSZ)
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     WS0914 (NOSZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAE10019
UniProt: Q7M9H5
Position
870521..871753
Genome map
AA seq 410 aa AA seqDB search
MQRLLKQSLVVTASLLALGTASLASSDLQTIMKERKLTEKDVLAAAKTYQPSGRKDEFVV
FSSGGQSGQILVYGVPSMRIYKYIGVFTPEPWQGYGFDDDSKKVLRQGDIRGREINWGDT
HHPNFTEKNGEYVGDYLFINDKANPRIAVVNLHDFETTQIVVNPIMKSEHGGSFVTPNTE
YVIEASQYAAPLDHQYHPIEEYEAVFRGAVTLWKFDYAKGKIDEKASFSLEFPPYMQDLS
DAGKGESFGWAFTNSFNSEMYTGGIEKGLPPFEAGMSRNDTDYMHVYNWQMLEKLAQDPK
NYKIYHGHRVISIEAAVKAGALFLIPEPKSPHGVDVSPDGRYIVVGGKLDTHASVYDFRK
IKQLIDKKEFIGADPYGIPILDMKKTLHGQVELYCHHLSRQLFENSSSSL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagattactaaagcaatctttggttgtgaccgctagcctattggcgcttgggaca
gcctctttggcttcgtctgatcttcaaacgatcatgaaggagcgaaagcttaccgagaag
gatgtgctagcggcggctaagacttaccagccaagcggaagaaaagatgagttcgttgtc
ttctcttcggggggtcagtcaggtcagattcttgtctatggggttccttcgatgagaatt
tataagtatattggtgtcttcacccctgagccttggcagggctatgggtttgatgatgat
tctaaaaaggttcttcgccagggggatattcgagggcgagagatcaattggggcgacaca
caccaccccaactttaccgagaaaaatggtgagtatgtgggggactacctttttatcaac
gacaaggccaaccctcgaatcgccgttgtgaatctgcatgacttcgagaccacgcaaatt
gttgtcaaccccatcatgaagagcgagcatggtggatcgtttgtgactcccaatactgaa
tatgtgattgaggcgagtcaatacgccgccccgcttgatcatcaataccatcccatcgaa
gagtatgaggcggtcttccgaggagcggtgacgctttggaagtttgactacgctaagggt
aaaatcgatgaaaaggcctctttttctctagagtttcctccctatatgcaggacttgagt
gatgcgggcaagggggaatcttttggctgggcattcactaactcttttaacagtgaaatg
tacactggcggaatcgaaaaaggactccctccctttgaggcgggaatgagccgtaacgat
actgactatatgcacgtgtataactggcagatgttagagaagcttgctcaagaccccaag
aattacaagatctatcacgggcaccgagtcatctccattgaggcggcggtcaaagcagga
gccctctttttgattcctgagcccaagtctcctcatggggtggacgtgagtccagatggg
cgatacatcgtggtaggcgggaagcttgacacacacgcttcggtctatgatttccgcaaa
atcaagcaacttatcgacaaaaaagagtttatcggcgctgatccttacggcattcccatt
ttagatatgaagaagacgttgcatgggcaagtcgagctatactgccaccatttgtcaaga
caactttttgagaattcatcttccagcctctag

DBGET integrated database retrieval system