KEGG   Wolinella succinogenes: WS0916Help
Entry
WS0916            CDS       T00146                                 

Gene name
NOSZ
Definition
NOSZ protein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
wsu  Wolinella succinogenes
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:wsu00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
873012..874424
Genome map
AA seq 470 aa AA seqDB search
MGPLHHTYDAQDGIIYTSLYVDSQIVKWDYKNLKVLDRVNVHYNIGHLDSMEGKSAKPKG
KYALALDKLSIDRFNPVGPLHPQNHQLIDIGGPKMELIYDLPIPLGEPHDVISIAADKLK
PQVTYPMGTNSRTGKQHEAMTLAGQERVERKGNEVKIYGTLIRSHINPEHVTVNKGDKVT
FYLTNLERAQDETHGFAVSGYNVHASVEPGKTVAVTFTADEEGVFPYYCTEFCSALHLEM
MGYLYVKDPKKKYESVKELKLQKMSKEQLESEYKKVIATNKATDDVIQSVVKFLKDKNYA
KYPKVKSLVEDALDQYGKIGEVKAKADESYKKGDVNGAILWEYQVWQYMVKTADVGLRAK
NNLAKELATPMKPAAQKGEEAYLKGGCNGCHVIGQVSSGPDLTGVLSRHENAEKWVFDFI
KNPASKYEEDYVKTMINYFNLRMPNQHMNDQEIKDIIEYLKWIDENAGLF
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
ttggggccattacatcacacctatgatgcgcaagatggaatcatctacacctctttgtat
gtcgattcgcagatcgtcaagtgggattataagaatcttaaagtgcttgatcgggtgaat
gttcactacaacattggacaccttgattctatggagggtaaatccgccaagcctaaaggc
aagtatgccctagcgcttgacaaactctctattgatcgattcaaccctgtgggtcctttg
catcctcaaaatcatcagctcatcgacatcggcgggccaaaaatggaactcatctatgat
ctgcccattcctcttggcgaaccccacgatgttatcagtattgcagcggataagctcaaa
cctcaagtgacctaccccatgggaaccaactcaaggacgggcaagcaacatgaggcaatg
acgcttgcaggccaagagcgtgtggaacgcaaaggcaatgaggtgaagatctatggaaca
ctgattcgaagtcacattaatcctgagcacgtcaccgtgaacaagggagataaggtgact
ttctacctcaccaatctagagcgagcacaggatgagacacatggatttgccgtgagtggc
tataacgtccatgcctctgttgagccaggcaaaacagtcgcggtcacattcacagccgat
gaagagggtgttttcccctactactgcaccgagttctgctcagcgcttcacttggagatg
atgggatacctctatgtcaaagatccaaagaaaaagtatgagtcagtcaaagagctgaag
cttcaaaagatgagcaaagagcaattggaatcggaatataaaaaggtcatcgccaccaac
aaggccacggatgatgtgatccagagcgtagtgaagttcctcaaagataaaaactacgcc
aaatatcccaaggtgaaatctcttgtggaggatgcgcttgatcagtatggcaagattggc
gaagtgaaggccaaagccgatgaatcctataaaaagggcgatgtcaatggggccattctt
tgggagtatcaagtttggcaatacatggtcaaaaccgctgatgtaggacttcgagcgaaa
aataaccttgctaaagagctggccactcccatgaagccagcggctcaaaagggtgaagaa
gcctacctcaagggaggttgcaacgggtgtcacgtgattggtcaggtgagttcaggccct
gatcttacaggggttctctcccgacatgaaaacgccgaaaaatgggtgtttgactttatt
aagaatcccgccagcaagtatgaagaggattatgtgaaaaccatgatcaactacttcaat
cttcgtatgcccaatcagcatatgaacgatcaggagatcaaagacatcatcgaatacctc
aaatggatcgatgagaacgcgggtctcttctaa

DBGET integrated database retrieval system