KEGG   Wolinella succinogenes: WS0939Help
Entry
WS0939            CDS       T00146                                 

Definition
(GenBank) METHYL-ACC. CHEMOTAXIS SIGNAL TRANSDUCTION
Organism
wsu  Wolinella succinogenes
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(894172..895866)
Genome map
AA seq 564 aa AA seqDB search
MLMGFLTNLSVKVKLFFLSGLLLFIMSVMGVLGIYSTGKINDADTILYEKGAVSIALVSE
LNTQFGLYRVAFYRYKTNLISLKDYEKVGQDFFDYVEKFNKEYSKIYLDSKDKEIHDELI
ANFKEYKKITLEVLKLLEQGRIEEADKMTSTVWVPQAGKTIKGVQDLFKDKLEDAKKLSD
SNDELAAQSQMLITILLLAGIATGILISLLIIRNITSSLTSIEEGLDSFFAFLSRESREA
KKITLNSSDEFGKMAGAINENVERIEKEIRSDSELIEEAKGVARRVQHGWYSQYIEKKTT
NPSLEEFKNSVNEMIKATKAHFTNMNVVLEQYAKYDYREELRLEGIEKGGVFEILVNDIN
TLRNAIVQSLRDSLQAGERLEEQSRLLNDSMQTLSQGTNEQAASLEESAAAIEEMSSSMH
SVNDRTSEVIKQSEEIKGVIGIIRDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRK
LAERTQKSLGEIEANTNVLVQSINEMGESIKEQAQGITQINEAIAQLDTVTQQNAGVADK
TDGIASMVASMAEGIVKEVRGKRF
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
ttgctcatgggatttttgacaaatctttccgtcaaggtcaagcttttctttctttcagga
ttactgctcttcatcatgtccgtcatgggtgttcttgggatttactcaacaggaaaaatc
aatgacgcagatacgattctctatgagaagggtgctgtatccattgctttagtctcagag
ctaaatacgcagtttggcctctatcgagtggctttttatcgatacaagaccaatcttatt
agccttaaggattacgaaaaagtcggtcaagatttttttgattatgttgaaaaattcaac
aaagagtactcaaaaatctatcttgatagcaaagacaaagagattcatgatgagctaatt
gcaaatttcaaagagtataaaaaaattaccctagaggtactcaagctccttgaacaaggc
cgcatcgaagaggcggataagatgacttcgaccgtatgggtgccccaagcaggcaagact
atcaagggagttcaagatctcttcaaggataaacttgaagatgctaaaaagctctctgac
tccaatgatgagctagccgctcaatcccagatgctcatcacgattctcttgcttgcggga
atcgccacaggaatcctcatctccctcctcatcatccgcaacatcacctcctccctcacc
tctatagaggagggacttgactctttctttgccttcctctcaagagaatctagagaagcc
aagaagatcactttgaactctagtgatgagtttggaaagatggcaggagcgatcaatgag
aatgtagagagaatcgaaaaagagattcgcagtgatagcgagctgattgaagaggctaaa
ggggtagctaggcgagtccagcatggctggtatagtcaatacattgaaaagaaaaccacc
aacccctccctagaagagttcaaaaatagtgtcaacgaaatgatcaaagccactaaagct
cactttaccaatatgaatgtggttctggagcagtatgccaaatacgattatcgggaagag
ctccgactagaaggaattgagaaaggaggagtatttgagatccttgtcaatgacatcaac
actctaagaaatgctattgttcaaagcctaagagattctctccaagcaggagaacgccta
gaggagcagagccgactcctcaatgattccatgcagactctaagccaaggcaccaacgaa
caagccgccagcctagaagagagtgccgccgctattgaagagatgagtagctctatgcat
agtgtcaatgatagaacctctgaggtgatcaaacagtctgaagagatcaaaggggtgatt
ggaatcattagagacattgccgatcaaaccaacctactggctttaaatgctgccattgaa
gccgcaagagcaggagagcatggaagaggatttgcagtcgttgccgatgaagtgagaaag
ctagccgagagaactcagaagtctttaggagagatagaggccaataccaatgttctagtt
caatcgattaatgagatgggagagagtattaaagagcaagcccaaggaatcactcagatc
aatgaggctattgcccaacttgataccgtaacccaacaaaatgcaggagtagcggataag
acggatgggattgctagtatggtggcaagcatggctgagggaattgtgaaggaggtgaga
gggaagaggttttag

DBGET integrated database retrieval system