KEGG   Wolinella succinogenes: WS1065Help
Entry
WS1065            CDS       T00146                                 

Gene name
SUCC
Definition
(RefSeq) succinyl-COA synthetase BETA chain (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
wsu  Wolinella succinogenes
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WS1065 (SUCC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WS1065 (SUCC)
   00640 Propanoate metabolism
    WS1065 (SUCC)
   00660 C5-Branched dibasic acid metabolism
    WS1065 (SUCC)
Enzymes [BR:wsu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     WS1065 (SUCC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027669..1028847
Genome map
AA seq 392 aa AA seqDB search
MNIHEYQAKALLAQYGVGIPRGGVAETPAEATVIAQRLGGEIWAIKAQIHAGGRGKAGGV
KLAKTPEEAGEIAKAMLGSRLITHQTSLEGKEVHKVYVEEGLGIEREYYLGIVLDRSLEM
PVIMASRQGGVDIEEVAKNSPNEIIKVAVDPMIGFRPFHGRKLAFALGLAKEQVGLFVDF
CTSLFRLYVQKDAEIVEINPLVFTSCKRFVALDAKISFDNNALYRHPEIVAMRDLSEEES
SEIEAGEYNLNYVKLQGNVGCMVNGAGLAMATMDIIKHEGGEPANFLDVGGGAKPETVAK
GFEIILKDPNVKAIFVNIFGGIVRCDRVANGILEAAKIVHVSVPVVVRLDGTNAKEAKEI
LEQANIPNIFAAPSLEGGAKKAVELACQGGAS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcaggcaaaagcccttttggcgcaatatggggtgggaattcct
aggggtggagtggcggaaacgcctgctgaggcgaccgtcatcgctcagagacttgggggc
gagatttgggcgatcaaggcccagattcacgctggaggtcgaggcaaagcaggcggggtg
aagctcgccaaaactcccgaagaggcaggggagatcgctaaagcgatgctaggctcaaga
ctcatcacacaccaaacctcgcttgaggggaaagaggtgcacaaggtttatgtcgaagag
gggttgggaattgaacgagagtattatctgggaatcgttctagatcgttctttggagatg
cctgtgatcatggcgagccgccaagggggcgtggatattgaagaggtggccaaaaatagt
cctaatgagatcatcaaggtggcggttgatcctatgattggatttcgtccttttcatggg
cgcaaactcgcttttgctctagggcttgctaaagagcaggtgggactttttgtcgatttt
tgcacttcgctctttcgactctatgttcaaaaagatgcagagattgtcgagatcaaccct
cttgttttcacctcctgtaagcgatttgtggcgcttgatgccaaaatctcctttgataac
aacgccctctatcggcacccagagattgttgcgatgcgtgatttaagcgaagaggaatcg
agcgaaattgaggcaggcgaatacaatcttaactatgtgaagcttcaggggaatgtcggc
tgtatggttaatggtgctggcttggcgatggctacaatggatatcatcaagcatgaaggg
ggagagcctgccaacttcttggatgtgggcgggggcgcgaagcctgagacggtggccaaa
ggttttgagatcattcttaaagaccccaatgtcaaggcgattttcgtcaatatttttgga
ggaatcgtgcgctgcgatcgcgtggccaatggaatcttggaggcggccaagattgttcat
gtctccgtccctgtagtggtgaggcttgatggcaccaacgccaaagaggccaaagagata
ttagagcaggccaatatccctaatattttcgccgctccttcgcttgagggtggagcgaaa
aaagccgtggagctagcttgtcaaggaggtgcttcatga

DBGET integrated database retrieval system