KEGG   Wolinella succinogenes: WS1115Help
Entry
WS1115            CDS       T00146                                 

Gene name
UAHA
Definition
urea amidolyase
Orthology
K01941  
urea carboxylase [EC:6.3.4.6]
Organism
wsu  Wolinella succinogenes
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:wsu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1071502..1075104
Genome map
AA seq 1200 aa AA seqDB search
MFQKVLIANRGEIACRIIRTLQHLQIASVAIYTDADADSLHVDLADEAYCIGESLVSESY
LQGAKILEIAKRSGAEAIHPGYGFLSENAAFARACEREGIVFIGPRPEQMESFGLKHTAR
ELAIQSGVPLLPGSGLLSDLLEAKSEAKRIGYPVMLKSTAGGGGIGMQLCSNEQELEESF
LTVKRLSENHFANSGVFLEKYVSTAHHIEVQVFGDRKGKVTILGDRDCSLQRRNQKVVEE
TPAPHLSQECRESLYACAKKLMESVSYLSAGTVEFIYDPLEQKFYFLEVNTRLQVEHGIT
EEVSGVDLVEWMVHQAYGLDPSSPITPQGHAIEVRLYAEDPAKNFQPSSGLLSEVRFPKG
VRCDTFVRTGVEVSPYYDPMIAKLIVKGESREEAIEKLSQALQETKVEGIVTNLDYLLGV
TQSETFLKGAQSTRFLNDFVVEGRGIDILSPGAQTSVQDYPGREGYWDVGVPPSGAFDSL
SFRYANALVGNHLEAAGLEMVMSGPTLRFNQEAIIALCGAEIQAELEGQIVPMNKAMLIP
KGATLKLKKIQGAGLRAYLAIRGGIDVPLYLGSRSTFTLGRFGGHAGRNLVAGDRLKVAS
MMQGEARFEVCAPMRPWGELWEIGVLYGPHGAPDFFTNKDIERFFEAEWEVHFNSNRTGV
RLIGPKPDWARRDGGEAGLHPSNIHDNAYAIGAVDFTGDMPVILGPDGPSLGGFVCPVSV
VSAEWWKIGQLKAGDRVRFIPIAHEDALAMLDAQEEAIQNLAPYDERPFLRALAPTTPRL
YEEEGEGELPALVVRQSGDAYLLVEYGEMTLDIARRFRVHLLMEALQKSQIQGIIDITPG
IRSLQIHFNPKICDRGELIERLKRIERNLPSADEMEVPSRTLYLPLSWDDPATKAAIEKY
MTTVRPDAPWCPSNIEFIRRINGLSSIEEVKRIVFEASYLVMGLGDVYLGAPVATPLDPR
HRLITTKYNPARTWTPENAVGIGGAYMCVYGMEGPGGYQFVGRTVQMWNRYPKEGDFVEG
KPWLLRFFDQIRFYEVSAEELLRLREEFPRGRVKLRVEEGSFSLRAYQAFLCEHQSSIEA
FKRTQQSAFEEERLMWERTGLANFNAQGEALESESQESLDLPQGVVQVESPLQGNLWKIL
VQEGERVSEGQVVMISESMKMEIPIEASESGTVVKVLVKEGENLHAGKGLLLLEVENSKA
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaaggttttgattgccaatcgtggcgagattgcctgccgcatcatacgcaca
cttcaacacctccaaatcgcttctgtggcgatctatacggacgctgatgccgattctttg
catgtggatttggcggatgaggcctattgtattggagaatctcttgtgagtgagagttat
cttcaaggggcaaaaatcttagagattgccaagcgaagcggagcggaagcgattcatccc
ggatatggatttttgagtgaaaatgccgcctttgccagagcttgcgagagagagggaatc
gtctttatcggacctagacccgaacagatggaatcctttgggctcaaacacaccgccaga
gagctggcgattcaaagcggagtgccactgcttccggggtcggggcttttgagtgatctc
ttggaggccaagagtgaagccaagcgtatcggttaccctgtgatgctcaaaagtactgct
gggggcggaggcatcggaatgcagctctgctccaatgagcaagagctagaagaatcgttc
ctcacggtgaagcggttgagcgagaatcacttcgccaatagcggagtttttttggaaaaa
tatgtgagcacggcacaccatattgaggtgcaggtttttggagataggaagggaaaagtg
acgattctaggggatcgggactgttcgcttcagcgccgaaaccaaaaagtggtcgaggag
actcctgcgcctcacctaagccaagagtgccgagaatcgctctatgcgtgcgccaagaag
ctcatggagagtgtctcttatctctcggcgggcacggtagagttcatctacgatcctcta
gaacaaaagttctactttttggaggtgaacactcgattgcaggtggagcatggaatcacc
gaagaggtgagtggggtggatttggtggagtggatggtgcatcaagcctatggactagac
ccctctagtccaatcactccccaaggtcacgcaatcgaggtgcgcctttatgccgaagac
cccgcgaaaaacttccagccaagctcagggcttttaagtgaagttcgattccccaaaggg
gtgcgatgtgacactttcgtgcgaacgggggtggaggtctctccctattatgaccctatg
attgccaagctcattgtcaaaggagagagtcgagaggaagcgatagagaagctctcccaa
gcccttcaagagaccaaagtggaaggaatcgtgaccaacttggactaccttcttggtgtc
acccagtcggagacttttttgaaaggggcgcagagcacgagattcttgaatgattttgtc
gtggaggggagggggattgatatcctctctccgggagcccaaacgagtgtacaagattat
ccgggtcgtgaagggtattgggatgtgggagtgcctccctcgggggcttttgattctttg
agttttcgctacgccaatgcgctggtagggaatcatctagaggcggcaggcttggagatg
gtgatgagcgggccaacactacgattcaaccaagaggcgatcatagcgctatgcggagcg
gagattcaagccgagcttgaggggcagatcgtgccgatgaataaggccatgttgattccc
aaaggagccacgctcaagctcaaaaaaatccaaggcgcagggctgcgtgcctatttggca
attcgcggggggattgatgtgcctctctatctagggagtcgttccaccttcaccttgggg
cgttttggaggccatgcgggaaggaatcttgtcgcaggagatcggctcaaggtggctagc
atgatgcagggggaggcgaggtttgaggtttgtgctcccatgcgcccttggggcgaactc
tgggagattggcgtgctctatggtcctcatggggcgcctgattttttcaccaataaagat
atagagcgattctttgaggcggagtgggaggtgcatttcaattccaaccgcacaggtgtg
cgcctcattggccctaagcctgattgggcgaggagagatgggggcgaggcgggcttgcat
ccctctaatattcacgacaatgcctacgccattggggcggtcgatttcacgggggatatg
cctgtgattttggggcctgatgggccaagccttggagggtttgtctgccctgtgagtgtg
gtgagtgcggagtggtggaagattggacagctcaaagcaggggatagagtgagattcatc
cctattgcccatgaggatgccctagcgatgcttgatgcgcaagaggaggcgatccaaaat
ctcgctccttatgatgagcgcccctttttgagggctcttgcgcccaccacgcctagactc
tatgaggaggagggcgaaggggagctccctgcgcttgtggtgcgccaaagcggagacgcc
tatcttttggtggagtatggagagatgacgctggatattgcgcggagatttcgtgtgcat
ctgctcatggaggcgctccaaaagagtcagattcaaggaatcatcgatatcactccggga
attcgctcgctccaaattcacttcaatcccaaaatctgcgaccgaggagagctcattgag
cggctcaagaggattgagcgcaatctcccctcagctgatgagatggaagtcccctctcga
acgctctatctgccgctctcatgggatgaccctgccactaaagcagcgatagagaagtat
atgaccaccgtgcgacccgatgcgccttggtgtccgagcaatattgaatttattcgccga
atcaatggactatcgagtatagaagaggtgaagcgaatcgtctttgaggcgagctatctt
gtgatgggcttaggagatgtctatttgggcgctcctgtggcgactccgctagaccctagg
catcgactcatcaccaccaagtacaatccagcgcgcacttggacacccgaaaatgccgtg
ggaatcgggggagcgtatatgtgcgtctatgggatggaggggccggggggctatcagttt
gttgggcgaacagtgcaaatgtggaatcgctaccctaaagagggtgattttgtcgagggc
aaaccttggcttttgcgcttttttgatcagattcgattctatgaggtgagcgctgaggag
cttttgcgtttgagggaggagtttcctagggggcgcgtgaagcttagagttgaggagggg
agttttagccttagggcgtatcaagcgtttttgtgtgaacatcaaagctccatcgaggca
ttcaagcgcacccagcagagcgcctttgaagaggagcggctcatgtgggagcgcacgggc
ttggctaatttcaacgcccaaggagaggcgctggagtcagagagtcaagaatcgctagat
cttcctcaaggggttgtccaagtggaatccccattgcaggggaatctatggaagattctt
gtccaagagggcgagagggtgagcgaggggcaggtggtgatgatctctgaatcaatgaag
atggagattcctatcgaggcgagcgagagtggcacagtggtcaaagtgcttgtgaaagag
ggagagaatctccatgcaggcaaggggcttttgctccttgaagttgagaattcaaaggca
taa

DBGET integrated database retrieval system