KEGG   Wolinella succinogenes: WS1213Help
Entry
WS1213            CDS       T00146                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
wsu  Wolinella succinogenes
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WS1213
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    WS1213
Enzymes [BR:wsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     WS1213
Two-component system [BR:wsu02022]
 CheA family
  CheA-CheYBV
   WS1213
Bacterial motility proteins [BR:wsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    WS1213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1163028..1163720
Genome map
AA seq 230 aa AA seqDB search
MAKSFDQRVPLEVEKKHHPDLLLPSNPHKKEGKKIILIGSSTGGVEALTRIFPKLPAGLP
PIVIVQHIPKGFSTSFAQRLNSISAFSVIEVSAREVLKDSHAYLAPGDKHLVIENVAGSY
LAKCVDGERISRHKPSVDVLFRSGNNAAGKNAMAIIMTGMGDDGSIGIKELFDNGAYTIA
QNEASCVVFGMPKKAIEKGAVSEVVSLDEIPQKIIEYAARSSDKGKNEPA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctaagagctttgatcagcgagtccctctagaagtggagaaaaaacatcaccccgat
ctccttctcccctctaatccccataaaaaagagggcaaaaaaatcatcctcattggctcc
tccacggggggcgtagaggctctcacgagaatcttccctaagctccccgcagggcttccg
cctattgtgatcgttcagcatatccccaaaggattctccacctcttttgctcaacgcctc
aactccatctcggcttttagtgtcattgaggtgagtgcgcgcgaagtgctcaaagattct
cacgcctatcttgccccaggagacaaacaccttgtgattgagaatgtcgctggaagctat
ttggccaaatgtgttgatggagagaggatcagtcgtcacaagccaagcgtggatgtgctc
tttagaagtggaaataatgctgcaggaaagaatgcgatggcgattatcatgacaggcatg
ggggatgatggtagtatcggaatcaaagagctttttgataatggagcctatacgattgcc
cagaatgaggcgagctgtgtagtctttggaatgcccaaaaaggcgattgaaaaaggggcg
gtgagcgaggtggtgagcctggatgagattccccagaaaatcatcgaatacgccgctaga
agtagcgataaaggcaaaaatgaacccgcctga

DBGET integrated database retrieval system