KEGG   Wolinella succinogenes: WS1351Help
Entry
WS1351            CDS       T00146                                 

Definition
(GenBank) TRYPTOPHAN SYNTHASE BETA CHAIN
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00260  Glycine, serine and threonine metabolism
wsu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
wsu01100  Metabolic pathways
wsu01110  Biosynthesis of secondary metabolites
wsu01130  Biosynthesis of antibiotics
wsu01230  Biosynthesis of amino acids
Module
wsu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WS1351
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    WS1351
Enzymes [BR:wsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     WS1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF4851
Motif
Other DBs
NCBI-ProteinID: CAE10422
UniProt: Q7M8W7
Position
1296756..1297964
Genome map
AA seq 402 aa AA seqDB search
MTMFMPTPSQFDPDERGHFGKFGGRFVPETLMPALLELESAYNELRFDREFWSEVDYYLK
EYVGRPSPLYYAERLSDELGAKIYLKREDLNHTGAHKINNTVIQGLLAKRLGKKKIIAET
GAGQHGVATATIAALLGLECEVFMGSKDTARQELNVFRMKLLSSKVQSVESGSKTLKDAM
NEAIRHWVTHARDTFYIIGTVAGPHPYPMMVRDFQSVISFEAKKQILEKEERLPDYVIAC
IGGGSNAAGMFARFLDEESVRCIGIEAGGLGIESHHHGASLAKGSPGILHGQMSYLLQDS
EGQIEEAYSISAGLDYPGIGPEHAYLFESGAAEYDHVTDAEALEAFVWLSQKEGIIPAFE
SAHAIAYLKKARERFKDKVVIVSLSGRGDKDMIQAKNLLNFH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgaccatgtttatgcccacccctagtcaatttgaccccgatgagagaggccattttgga
aaatttggcgggagatttgtccctgagacactgatgcctgcgctcttagagctagagagt
gcctacaatgaattacgctttgatcgagagttttggagcgaggtggactactacctcaaa
gagtatgtgggtcgccccagccccctctattatgcggagcgtttgagcgatgagttagga
gccaaaatctacctcaagcgcgaagacctcaaccacacgggcgctcacaaaatcaataac
actgtcatccaaggactactcgccaaacgccttggcaagaagaagatcatcgccgagaca
ggcgcagggcaacatggagtcgcgaccgcgaccatcgccgcgcttttgggtctagagtgc
gaggtctttatgggctccaaagacaccgccaggcaagagcttaatgtctttcgcatgaag
ctccttagctccaaagtgcaaagcgtggaatcgggctcaaagacactcaaagatgcgatg
aatgaagccatcagacattgggtcactcacgcgcgagacaccttctatatcattggcacc
gtggcaggcccccatccctatcccatgatggtgagggattttcagagtgtcatcagcttt
gaagctaaaaagcagattttagagaaagaggagcgactgcccgattatgtcatcgcttgc
atcggcggagggagtaatgccgcagggatgtttgctcgatttcttgatgaggagagcgtg
agatgcatcggcattgaagcaggggggcttggcatagagagtcatcaccatggcgccagt
ctcgccaagggatcacctgggattcttcatggacagatgagctacctccttcaagatagc
gaggggcagatcgaggaggcctattctatctcggcaggacttgattatccagggattggc
cctgaacatgcctacctctttgaaagtggcgcggcggagtatgatcatgtgaccgatgcg
gaggctttggaggcgtttgtgtggctaagccaaaaagagggaatcatccctgcttttgag
agtgctcacgccatcgcctacctcaaaaaagcgcgcgagcgcttcaaagataaagtggtg
attgtctcgctttcaggtcgaggggacaaggatatgattcaagcaaagaatcttctcaac
ttccactaa

DBGET integrated database retrieval system