KEGG   Wolinella succinogenes: WS1376Help
Entry
WS1376            CDS       T00146                                 

Gene name
CHEY
Definition
chemotaxis protein CheY
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
K03413  
two-component system, chemotaxis family, response regulator CheY
Organism
wsu  Wolinella succinogenes
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WS1376 (CHEY)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    WS1376 (CHEY)
Enzymes [BR:wsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     WS1376 (CHEY)
Two-component system [BR:wsu02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   WS1376 (CHEY)
Bacterial motility proteins [BR:wsu02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    WS1376 (CHEY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319084..1320388
Genome map
AA seq 434 aa AA seqDB search
MPKNILVVDDNEDNRIALEILLERFADLKIFSAQNGQEAVELCQKEPMDIVFMDIMMPEM
DGIEATKKIREFDRSTMIVAVSALGDEESQKKMILYGAEDYIVKPIIQDVFKRRLQNYLE
IIASRKKRHFDQKAHNLFTKRVFNRSLLFRINHPTGLSEFWEYYLLDSPKSSEEIHACVR
LLYAFGRFILKSGALAEIISEEDHSHLYLSLTSIDKLNRSSLQRVILKNYPEAQFILSSS
MLTFKLPKTLTSLTCAPLLESKEESYEMCILRKRHVDCMDAKTYVENTPFSLLNSVDMLE
DNEDVIDKAISRFENFPTLGNLHAIGELFAGHAEVLEQLLEFEHLAFGVRSLSTLLATLD
DSKLSLVAPKFLGVMLTTILEDLTQWRRNIFLDKNARDIHYLDSSLFSSCLQAQALFEEK
SPSQEEDDNDLELF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagaatatcctagtggtggatgacaacgaggacaaccgaatcgcgcttgagatt
cttttagagcgctttgctgatctcaagatttttagcgcccagaatggccaagaggcggtg
gaactttgtcaaaaagagcccatggatattgtctttatggacatcatgatgcctgagatg
gatggaattgaggccaccaaaaagattcgagagtttgatcgaagcacgatgattgtcgct
gtctctgcgctaggcgatgaagaatcgcaaaaaaagatgattctctatggagccgaagac
tacatcgtcaagcccatcatccaagatgtctttaagcgacgtcttcaaaactatctcgaa
atcatcgcctcacgcaaaaaaaggcattttgaccaaaaggcgcacaaccttttcaccaag
cgcgtcttcaatcgctctcttctctttcggatcaatcaccccacgggtctgtcggagttt
tgggaatactatctgctcgattctcccaagagctctgaggagattcatgcttgcgtgaga
ctgctctatgcttttggacgctttattctcaaaagtggtgctttagcggagattattagc
gaagaggatcactcccatctctacctctccctcacctccattgataagctcaatcgctct
tcgcttcaacgcgtgattctcaaaaactatcccgaagcgcagtttatcctctcctcctcc
atgctcaccttcaagctccccaaaaccctcacctcactcacgtgcgcccctctcttggag
agcaaagaagagagttatgagatgtgcatcttgcgcaaacgccatgtcgattgcatggac
gctaaaacctatgtcgaaaacaccccctttagcctcctcaattctgtggatatgctcgaa
gacaacgaggatgtgatcgataaggcgatcagtcgatttgaaaacttccctacacttgga
aatctgcacgctattggagagctttttgcagggcatgccgaggtgctagagcagctttta
gagtttgagcacctcgcttttggagtgcgctctttgagcactcttttggccacccttgat
gattccaagctctcgctcgtcgccccgaaatttcttggcgtgatgctcaccacgatctta
gaagatctcacccaatggaggcgcaacatcttccttgataaaaatgctcgggatattcac
tatcttgatagctcactctttagctcctgcctccaagcccaagctctttttgaggagaaa
agtccctcccaagaggaagacgacaacgatttggagctcttttaa

DBGET integrated database retrieval system