KEGG   Wolinella succinogenes: WS1376Help
Entry
WS1376            CDS       T00146                                 

Gene name
CHEY
Definition
chemotaxis protein CheY
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
K03413  
two-component system, chemotaxis family, response regulator CheY
Organism
wsu  Wolinella succinogenes
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:wsu02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:wsu02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1319084..1320388
Genome map
AA seq 434 aa AA seqDB search
MPKNILVVDDNEDNRIALEILLERFADLKIFSAQNGQEAVELCQKEPMDIVFMDIMMPEM
DGIEATKKIREFDRSTMIVAVSALGDEESQKKMILYGAEDYIVKPIIQDVFKRRLQNYLE
IIASRKKRHFDQKAHNLFTKRVFNRSLLFRINHPTGLSEFWEYYLLDSPKSSEEIHACVR
LLYAFGRFILKSGALAEIISEEDHSHLYLSLTSIDKLNRSSLQRVILKNYPEAQFILSSS
MLTFKLPKTLTSLTCAPLLESKEESYEMCILRKRHVDCMDAKTYVENTPFSLLNSVDMLE
DNEDVIDKAISRFENFPTLGNLHAIGELFAGHAEVLEQLLEFEHLAFGVRSLSTLLATLD
DSKLSLVAPKFLGVMLTTILEDLTQWRRNIFLDKNARDIHYLDSSLFSSCLQAQALFEEK
SPSQEEDDNDLELF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagaatatcctagtggtggatgacaacgaggacaaccgaatcgcgcttgagatt
cttttagagcgctttgctgatctcaagatttttagcgcccagaatggccaagaggcggtg
gaactttgtcaaaaagagcccatggatattgtctttatggacatcatgatgcctgagatg
gatggaattgaggccaccaaaaagattcgagagtttgatcgaagcacgatgattgtcgct
gtctctgcgctaggcgatgaagaatcgcaaaaaaagatgattctctatggagccgaagac
tacatcgtcaagcccatcatccaagatgtctttaagcgacgtcttcaaaactatctcgaa
atcatcgcctcacgcaaaaaaaggcattttgaccaaaaggcgcacaaccttttcaccaag
cgcgtcttcaatcgctctcttctctttcggatcaatcaccccacgggtctgtcggagttt
tgggaatactatctgctcgattctcccaagagctctgaggagattcatgcttgcgtgaga
ctgctctatgcttttggacgctttattctcaaaagtggtgctttagcggagattattagc
gaagaggatcactcccatctctacctctccctcacctccattgataagctcaatcgctct
tcgcttcaacgcgtgattctcaaaaactatcccgaagcgcagtttatcctctcctcctcc
atgctcaccttcaagctccccaaaaccctcacctcactcacgtgcgcccctctcttggag
agcaaagaagagagttatgagatgtgcatcttgcgcaaacgccatgtcgattgcatggac
gctaaaacctatgtcgaaaacaccccctttagcctcctcaattctgtggatatgctcgaa
gacaacgaggatgtgatcgataaggcgatcagtcgatttgaaaacttccctacacttgga
aatctgcacgctattggagagctttttgcagggcatgccgaggtgctagagcagctttta
gagtttgagcacctcgcttttggagtgcgctctttgagcactcttttggccacccttgat
gattccaagctctcgctcgtcgccccgaaatttcttggcgtgatgctcaccacgatctta
gaagatctcacccaatggaggcgcaacatcttccttgataaaaatgctcgggatattcac
tatcttgatagctcactctttagctcctgcctccaagcccaagctctttttgaggagaaa
agtccctcccaagaggaagacgacaacgatttggagctcttttaa

DBGET integrated database retrieval system