KEGG   Wolinella succinogenes: WS1491Help
Entry
WS1491            CDS       T00146                                 

Definition
cytochrome C551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
wsu  Wolinella succinogenes
Brite
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     WS1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1426933..1427976
Genome map
AA seq 347 aa AA seqDB search
MLKQVVMFGSMVLAATTLLADDAALIKKVKEAGILALPKDPKALTKLAEQSEDAKLNPTT
KEKVELGKKLYFDPRLSRSNLISCNTCHNLGLGGADAVPAAIGHKWTANPSHLNSPTVYN
SVFNSVQFWDGRSAHLADQAQGPIQAGPEMAAPKELVEERINSIPAYVAEFKKAYGKDVK
VDFKLIADTIAVFERTLVTPSRFDDFLNGDSKALSKAEKEGLDLFIEKGCTACHTGVNLG
GTMQPFQVAAQYKFASLGDFKGDANGMVKTPTLRNITETAPYFHNGAFWSLSDAIKEMGS
TQLGIAISDAEAGKIATFLGSLEGRKPKVDYPMLPAMTDATPKPTFD
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcaagttgtaatgtttggaagtatggtgttggctgcaaccaccctgctcgct
gatgatgccgcactcatcaaaaaagtcaaagaggcaggaatcctcgctcttcccaaagac
cccaaggcgctcaccaagctagccgagcaatccgaagatgccaaactcaatcccaccacc
aaagagaaggtcgagctaggcaaaaaactctactttgatcctagactttctcgaagcaat
ctcatctcctgtaacacctgtcacaatctaggccttggaggtgcggacgccgttcccgcc
gctattggacacaagtggactgccaacccctctcacctcaactctcccacggtctataac
agcgtttttaacagcgttcaattttgggatggacgaagcgctcacctcgccgatcaagcc
caaggccccatccaagcaggccctgaaatggcagctcccaaagagctagtcgaagagcga
atcaactccattcccgcctatgttgccgagttcaagaaggcttatggcaaagatgtcaag
gtggatttcaagctcatcgctgatacgatcgccgtttttgagcgcaccctagtcacgcct
tctcgctttgatgatttcctcaatggcgattccaaagccctcagcaaagccgaaaaagag
ggtcttgatctattcatcgaaaaaggatgcaccgcctgccacacaggagtcaacctcggc
ggaaccatgcaacccttccaagtcgccgctcaatacaaattcgctagcctaggagacttc
aaaggagatgccaatggcatggtgaaaactcccacgctaagaaacatcaccgaaaccgcc
ccctacttccacaatggagccttctggtcgctcagtgatgcaatcaaagagatgggcagc
acccagctaggcattgcaatcagcgacgctgaagcgggtaaaatcgccaccttccttggt
tcactcgaaggccgcaagcccaaagttgactatcctatgcttcctgcaatgacagacgct
actcccaagcctactttcgactaa

DBGET integrated database retrieval system