KEGG   Wolinella succinogenes: WS1603Help
Entry
WS1603            CDS       T00146                                 

Gene name
guaA
Definition
GMP synthase (EC:6.3.5.2)
Orthology
K01951  
GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
wsu  Wolinella succinogenes
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:wsu00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1515484..1517049)
Genome map
AA seq 521 aa AA seqDB search
MSIQLHDKVSLLILDFGSQYTQLIARRLREYGIYCEIVPYHEKLEAIKAREPKGIILSGG
PASVYEEDAFLIDKAVFELGIPVLGICYGMQLMTHYFGGVVAKAEHHEYGKAEVIFDALE
GSESKLFEGCHSGKVVWMSHGDKVEKLPEGFTRIAHSTNSPFAAIAHQEKPFYAVQFHPE
VVHSEEGALYLKNFALGICGCENDWNMHNFAEEQIKKIQERVKSGKVLCAVSGGVDSSVV
AALLYRAIGEKLIPVFVDHGLLRAGEREAVEKMFKENLHVPLITVDASEIFLGKLKGVSD
PETKRKIIGETFIEVFDVEAKKHDGIQYLAQGTLYPDVIESVSVKGPSKTIKSHHNVGGL
PDWMTFELIEPLRELFKDEVRALGAELGMPREMLMRHPFPGPGLAIRIMGEVNFEDLELL
RKADVIMLDELKKSGFYDKTWQAFTVLLNVRSVGVMGDNRTYDNTVCVRVVEAIDGMTAT
FAHLPHELLERMSTRIINEVDGINRVVYDISSKPPATIEWE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcaactacacgataaggtttcgctactgattttggactttgggagccaatac
actcagctcatcgcaaggcgactaagggagtatggaatctactgcgaaatcgtcccctac
cacgagaagctagaggcgattaaagcacgcgaacccaagggaatcatcctcagcggggga
ccagcgagcgtctatgaagaggatgctttcttgattgataaggcggtttttgagcttgga
attcctgttcttggaatctgctatggaatgcagctcatgacccactactttggcggtgtg
gtggccaaggcggagcatcatgaatatggcaaggctgaggtgatttttgatgcccttgag
gggagtgagtcgaagctttttgaagggtgccatagcggcaaagtggtctggatgagccat
ggcgacaaggtggagaaattgcctgaaggattcacaagaatcgcccactccacgaactct
ccctttgcggcgattgcccaccaagagaagcctttttatgcggtgcagtttcaccccgag
gtcgtccactctgaagagggagcgctctatcttaaaaatttcgctctaggaatctgtggc
tgcgaaaatgattggaatatgcataacttcgccgaggagcagatcaaaaagattcaagag
cgcgtcaagtcgggcaaagtgctctgcgccgtctcgggtggggttgattcaagcgtagtg
gctgcgcttttatatcgcgcgattggggagaagctgattcctgtttttgtcgatcatggg
cttttgagggcaggtgagcgcgaggcggtcgagaagatgttcaaagagaatctccatgtt
cctctgatcacggtggatgcaagcgagattttccttggcaagctcaaaggggtgagcgat
ccagagacgaagcgtaaaatcatcggcgagaccttcattgaggtgtttgatgtggaggcg
aaaaagcatgatggcatccaatatcttgctcaaggcacgctctatcctgatgtgatcgaa
tcggtctccgtcaagggccccagcaagacgattaagtcccaccacaatgttggcggactg
cctgattggatgacctttgagctgattgagcccctaagagagctcttcaaggatgaggtg
agggcgcttggagcggagcttgggatgccaagagagatgctcatgcgccatcctttcccc
ggaccggggttagctatccgtatcatgggcgaggtcaactttgaagatttggagcttttg
agaaaagcagatgtgatcatgcttgatgagctcaaaaagagtggcttttatgacaaaact
tggcaggcgttcaccgtgcttctgaatgtgcgaagcgtaggcgtgatgggcgataaccgc
acctatgacaacacggtctgcgttcgcgtggtcgaggcgattgatgggatgactgcgact
tttgcgcatctgccccatgagcttttagagagaatgtccacacgaatcatcaacgaagtg
gatggaatcaaccgcgtggtctatgatatcagctccaagccgcctgccacgattgagtgg
gagtga

DBGET integrated database retrieval system