KEGG   Wolinella succinogenes: WS1643Help
Entry
WS1643            CDS       T00146                                 

Gene name
FOLK
Definition
pyrophosphokinase-7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
wsu  Wolinella succinogenes
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WS1643 (FOLK)
Enzymes [BR:wsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     WS1643 (FOLK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1558995..1559480)
Genome map
AA seq 161 aa AA seqDB search
MIIAPLGENRALCYDKFFPSPFRPSSKRYEVVIGVGGNLGEVPRSLQGLFRALQKAKRVD
IISTSPLYYNPAFGYTEQAPFYNATMRLGWSGGYGEFFAYTSYLERRFGRPRKRAFKNAP
RSLDIDILFFDGMKIKTPSLTIPHPCWAERDFVLIPLMLDS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgcgcctttgggtgagaatcgggctttatgctatgataagtttttcccttcc
ccctttcgtccctcttcaaagcgctatgaggtcgtgattggagtcggcgggaatctaggt
gaggttccgcgctctttgcaggggctctttagggcgcttcaaaaagccaaaagagtggat
ataatttcaacatcgccgctctattacaacccagcgtttgggtacacagagcaagcccct
ttttacaatgcaaccatgaggcttgggtggagtgggggttatggggagtttttcgcctat
acaagctatctagagaggcgctttggacggcctaggaagcgagcgtttaaaaacgctccg
aggagtcttgatatcgacattctcttctttgatgggatgaagataaaaactccaagcctc
acgattccccatccttgttgggcggagcgggattttgtgttgattccattgatgttagat
tcttaa

DBGET integrated database retrieval system