KEGG   Wolinella succinogenes: WS1732Help
Entry
WS1732            CDS       T00146                                 

Gene name
FOLP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
wsu  Wolinella succinogenes
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WS1732 (FOLP)
Enzymes [BR:wsu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     WS1732 (FOLP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1632444..1633589
Genome map
AA seq 381 aa AA seqDB search
MFVQKIDPANLTAYLTALHSDKGGIHIMAKKGEQFFFKIYRLKTQAALILKQDCLSLGAE
FATPKEAILFKEPYQDGILIANQKHLELLIKKCQTQPFGLKELAQTLKSYLKTPSQPLQL
MGIINANEDSFYDKSRFLGENALWRIEEMIKEGAHIIDIGAASTRPGSDWVSEEEELKRI
RPIAKAIQESRLFERVKFSIDTYNPSVAELCLDCGFSLINDITALKNPRMVSLAKERQCE
VVIMHMQGESPRLMQQNPHYENVIETVDRFFVERIETLHESGVTQITLDVGIGFGKSVEH
NLKLIRHLSHFKRFGLPLLVGASRKSLIHALSPSMTEERLPGTLILHAEAHKAGASLIRC
HDVKEHAQAFKILQALESTEA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgtccaaaaaattgatcctgccaacctcaccgcctatctcaccgccctccactcc
gacaaaggcggaatccacatcatggccaaaaaaggcgagcagttcttcttcaaaatctat
cgcctcaaaactcaagccgccctcatcctcaaacaggattgtctctcgcttggggcagaa
ttcgccacccccaaagaggcgattctctttaaagagccctatcaagatggcatcctcatc
gccaaccaaaaacatctagagcttctcattaaaaagtgccaaactcaaccctttggactc
aaagagctcgcccaaaccctcaaaagctatctcaaaaccccctctcagcccctccagctt
atgggaatcatcaacgccaacgaagatagcttctatgacaagagtcgattcctcggagaa
aatgctctttggcgcatcgaagagatgatcaaggaaggggctcacatcattgatattggc
gcagcctccacgcgtccggggagtgattgggtgagcgaagaggaggagctaaaacgcatc
cgacccatcgccaaagcgattcaagaatcgcgtctctttgagcgggtgaaattcagtatc
gacacctacaatcctagcgtcgcagagctctgtttggattgtggatttagcctcatcaat
gacatcaccgcgctcaaaaatcctcgcatggtgagcctcgccaaagagcggcagtgcgag
gtagtgatcatgcatatgcaaggagaatctcctcgattgatgcagcaaaatccccactac
gaaaatgtgatcgagacggtcgatcgattctttgtcgagcgaatcgaaaccctccacgaa
tcgggagtgactcaaatcacgctagatgtgggaattggctttggcaagagcgtggagcac
aatctcaaactcatccgccacctctctcacttcaagcgctttggtctgccgctccttgta
ggggcaagccgcaaatctctcattcacgccctctccccctcaatgactgaggagcgcctc
cctggcactctcatcctccacgccgaagcccacaaggcgggagcaagcctcatacgatgc
cacgatgtcaaagaacacgcccaagccttcaaaatcctgcaagccctagaatcgactgag
gcgtag

DBGET integrated database retrieval system