KEGG   Wolinella succinogenes: WS1747Help
Entry
WS1747            CDS       T00146                                 

Definition
protein disulphide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
wsu  Wolinella succinogenes
Brite
Enzymes [BR:wsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     WS1747
Secretion system [BR:wsu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   WS1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1643881..1644633
Genome map
AA seq 250 aa AA seqDB search
MTKTLLKVALASSLVASLALAKSFEENLEALVQTKTGMPIKVVKSYELEGFKEMKFVSVE
SATSGQRFPLFASLDGNNIIGFSNLFFTQNAKNDEIVQNAIKEIQNFNETAKGKKLNEIF
KSIPENRYVNLKSTGNNVKKTLVVVTDPECPYCRNEMKTIEEKLKDHHIKIILAPVGART
AFVKSQIAMDKIKEAKSDKEKISILREVYADSYKIPENLRNQPTKLIDENAEKIYSSGLI
RGVPFVFEME
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaccctgctcaaagtcgccctcgccagctcccttgtcgcctccttggctctt
gctaaaagctttgaagagaatctcgaagctctagtccaaaccaaaacaggcatgcccatc
aaagtggtcaaaagctacgaacttgaaggcttcaaagagatgaagttcgtgagcgttgag
agcgccactagcggccagcgattccctctgtttgcctcactagatggcaacaatatcatt
ggattctctaatctcttcttcacccaaaacgccaaaaatgatgagatcgtccaaaacgct
atcaaagagattcaaaacttcaacgagaccgccaaaggcaaaaagctcaacgaaattttc
aaatcgattcctgagaatcgctatgtgaatctcaaatccacaggcaacaatgtcaaaaag
acgcttgtggtcgtcaccgaccctgagtgcccctactgccgcaacgagatgaagacgatt
gaagagaagctcaaagatcaccacatcaaaattatcctcgctcccgtgggtgcacgcacc
gcttttgtgaagagccagatcgccatggataagattaaagaggccaagagcgataaagag
aagatctctatcctaagagaggtctatgcagacagctacaaaattcctgaaaaccttcgc
aatcaacccaccaaactcatcgatgaaaatgccgaaaagatctacagtagcggtcttatt
cgaggggttccttttgtttttgaaatggaatag

DBGET integrated database retrieval system