KEGG   Wolinella succinogenes: WS1821Help
Entry
WS1821            CDS       T00146                                 

Gene name
HEMB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
wsu  Wolinella succinogenes
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WS1821 (HEMB)
Enzymes [BR:wsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     WS1821 (HEMB)
Exosome [BR:wsu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WS1821 (HEMB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1715289..1716260
Genome map
AA seq 323 aa AA seqDB search
MFKRLRRVRLNPTLRELVQEHHLRPSDFIYPLFIRHGEGIKNEVASMPGVYQMSLDVALQ
ECEELLALGLSSIILFGIPETKDSIGSEALCEHGIMAQSLRAIKERFPKMFVSVDLCFCE
YTDHGHCGIIDPKTQSVDNDATLEILAEQALILAQAGADMIAPSGMMDGMITTLRSALDK
AGFVNLPLMSYSTKFASAYYGPFRDVAQSAPSFGDRRTYQQNPANRREAILESLRDEEEG
ADILMVKPALAYLDIIRDVRERTLLPLAVYNVSGEYAMLKAAQKAGIIDYERVMMETLLS
FKRAGADIIITYHAKEAAKLLSI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaagattgcgccgagtgcgcctcaaccctaccctaagagagttggtccaagag
caccatcttcgccctagcgacttcatctatcccctctttatccgccatggtgaaggaatc
aaaaatgaagtcgcctccatgccgggcgtctatcaaatgagccttgatgtggcgctccaa
gagtgcgaagagctcctagcgctaggactctctagtatcatcctttttggaatcccagaa
accaaagacagcatcggaagcgaggcgctttgcgaacatggcatcatggcccaatccctt
cgagcgatcaaagagcgctttcccaagatgttcgtgagtgtcgatctctgtttttgcgaa
tacaccgaccacggccactgcggtattatcgatcccaaaacccaaagcgtggacaatgat
gccaccctagagattctcgccgagcaggccttgattttggctcaagctggagcggacatg
atcgcccctagcggcatgatggatgggatgatcacaaccctaagaagcgcgctggataag
gcaggatttgtcaatctccccctcatgagctactcgaccaaatttgccagcgcctactat
ggacctttcagggatgtagcccagtccgcccccagctttggcgatcgccgcacctatcag
caaaaccctgccaatcgacgcgaagcgattctggagagcttgagggatgaagaggagggg
gctgatattctcatggtcaaacccgcgcttgcctatcttgatatcatccgagatgtgcgc
gagcgcactcttttgccactcgctgtctataatgtaagtggcgagtacgcgatgctcaaa
gctgcccaaaaagcaggaatcatcgactatgaacgcgtcatgatggagacgcttcttagc
ttcaagcgcgctggagcggatatcatcatcacctatcacgccaaagaggccgccaagctt
ctctcaatctaa

DBGET integrated database retrieval system