KEGG   Wolinella succinogenes: WS1827Help
Entry
WS1827            CDS       T00146                                 

Gene name
TRPA
Definition
(GenBank) TRYPTOPHAN SYNTHASE ALPHA CHAIN (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
wsu  Wolinella succinogenes
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WS1827 (TRPA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WS1827 (TRPA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    WS1827 (TRPA)
Enzymes [BR:wsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     WS1827 (TRPA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1720156..1720923
Genome map
AA seq 255 aa AA seqDB search
MESFGVLSMKKLVAYITAALPDKEFTIDLALALSASGVDSLELGVPFSDPVADGPIIEHA
NLLALQKGFSLQDLYEITEKISPSIDTLWMGYLNPFHKVGFEQTCQKAKSLGVSGLIIPD
VPFEESAPFEEQCLQNNLALIRFIAPTLGTSRIATIAPMARKFIYLVAYAGITGSGREEP
LSPLIEEIRAINPEIPLYLGFGVNEHNAKEKSKEVDGVIVGSALVKVLLDERLTNTQKMT
TICALAKSIKESINS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
ttggagtcctttggagttttatctatgaagaagctcgtcgcctacatcaccgccgccctc
cccgataaggagttcaccatcgaccttgcgcttgccctaagtgctagcggagtcgattct
ttggagcttggagttcccttttctgaccctgtggccgatggcccgattatcgagcacgcc
aatcttttagccctgcaaaagggctttagcctccaagacctctatgagatcaccgagaag
atatccccaagcattgacaccctttggatgggctatctcaacccttttcataaggtgggg
tttgagcagacctgccaaaaggccaaaagcctaggagttagtgggctcatcattcccgat
gtcccctttgaagagagtgcgccctttgaggagcaatgcctccaaaacaatctcgccctt
atccgcttcatcgctcccactctaggcacctctagaatcgccaccattgctcccatggcg
agaaaattcatctatcttgtcgcttacgctggaatcacgggtagcggcagagaagagcct
ctctcgcctcttattgaggagattcgcgccatcaaccctgagatccccctctatcttgga
tttggcgtgaatgagcacaacgccaaggagaaatccaaagaggtggatggtgtcattgtc
ggaagtgcactggtgaaagtcctgctagatgagcgcttgacaaacacccagaaaatgact
acaatctgcgccctcgccaaaagcatcaaagagtcgatcaactcttaa

DBGET integrated database retrieval system