KEGG   Wolinella succinogenes: WS1844Help
Entry
WS1844            CDS       T00146                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.-)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
wsu  Wolinella succinogenes
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:wsu01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:wsu00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735775..1737511
Genome map
AA seq 578 aa AA seqDB search
MLDKIYRVNMTTMDFSIEEAPAEWMGLGGRGLTSTIVAAEVDPECHPLGPNNKLVFAPGM
LSGTSAANSGRNSCGAKSPLTGGIKESNVGGTSAAIMAKLGVKALIIEGMPKEGAPFYHL
HITKEKVEFFPVPELVGKNNYEVLDYMLEKYHKKVAVMSIGTPGEMRMNLANISVKDPGG
KLRSHGRGGMGAVMGSKKVKCITVDAESYNEITLANPEKFKEASKIFTKTLQENPISGQG
LPAFGTNVLVNILNEAGGLPTRNFREGRWEFAENICGETMAENIKARGGKTTHGCHAGCV
IQCSQIYNDADGNYLTSGFEYETIWAFGSNAGIQDLDQIAKIDALMDDLGVDSIETGVTL
GIAVDAGIVNYGDGEKIYDLIKNDIAKGTPLGRILGGGTHLVGKLYGLVRVPTVKGQGMP
AYEPRAVKGQGVTYATSTMGADHTAGYAVATNILNSGGYVDPLKKEGQIILSRNLQIATA
AVDSTGMCIFVAFPLLDDPKSLTALVDMINARFGTSLTGDDVTNLGMKILKTERAFNLKA
GLTPSDDRLPEFMKYESLPPHNVVWDFTNEELDSFWDF
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgttagacaaaatctaccgcgtcaatatgacgactatggatttttctatagaagaggca
cccgctgagtggatggggcttggcggtcgaggtcttacttcaaccattgttgcagccgaa
gttgaccctgagtgtcatcctctaggacccaacaacaaactcgtctttgctccgggtatg
ctctcaggcacaagcgctgctaacagtggcaggaactcctgtggagccaaaagcccgctt
acaggcggaatcaaagaatccaatgtcggtggaaccagcgcagcgatcatggccaaacta
ggcgtcaaagcgctcatcatcgaaggaatgcctaaagaaggggcacctttttaccatctg
cacatcacaaaagagaaggtcgaattcttccctgtacccgaacttgtaggcaaaaacaac
tacgaagtgctcgattatatgcttgagaaatatcacaaaaaagtggcggtgatgagcatc
gggactcccggagagatgcgcatgaatctcgccaacatctccgtcaaagatcccggaggc
aagctacgaagccacggtcgaggcggcatgggtgcagtgatgggctctaagaaggtcaaa
tgcatcaccgtggatgctgagagctacaatgagatcactctcgccaatcctgaaaaattc
aaagaggcgagcaaaattttcaccaaaaccctccaagagaatcccatcagcggccaaggc
ctacccgcctttggaaccaatgtccttgtcaatattcttaatgaagcaggggggcttccc
acgcgaaacttcagagagggtcgatgggaatttgccgagaatatctgcggtgagacaatg
gcagaaaatatcaaggctcgcggcggaaagaccacgcatggatgccacgcaggatgcgtg
attcagtgttcccaaatctataacgatgcggatggaaactacctcacttcaggctttgag
tatgagactatttgggcgtttggctccaatgcaggaatccaagacttagaccaaatcgcc
aaaatcgatgcactcatggatgatcttggggtcgattcgattgaaacaggggtcacccta
ggcatcgccgtggatgcgggaatcgtcaattatggcgatggagagaagatttatgacctc
atcaaaaacgatattgccaaaggaactcctttgggcagaatcttagggggcggaacccat
cttgtcgggaagctctatggcttagtgcgcgttccgaccgtcaaaggacaagggatgccc
gcctatgagccccgcgctgtcaaaggacaaggggtcacctacgccacctccacaatgggt
gctgaccacaccgctggctatgcggtcgcgaccaacatccttaatagcggtggttatgtc
gatccactcaaaaaagagggtcaaatcatcctctctcgtaacctccaaatcgccaccgcc
gcggtggatagcacaggtatgtgtatctttgtcgccttccctttgctcgatgacccaaaa
tcactaaccgcgctagtggatatgatcaacgcgcgctttggcacctccctcacaggagat
gatgtcaccaatctaggaatgaaaatcctaaagaccgagcgcgccttcaacctcaaagca
ggtctcaccccctcagatgatcgcctgcctgaattcatgaaatacgaaagcctccctccc
cataatgtcgtgtgggatttcaccaacgaggagctcgattccttttgggatttctag

DBGET integrated database retrieval system