KEGG   Wolinella succinogenes: WS1844Help
Entry
WS1844            CDS       T00146                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.-)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
wsu  Wolinella succinogenes
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WS1844
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    WS1844
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     WS1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735775..1737511
Genome map
AA seq 578 aa AA seqDB search
MLDKIYRVNMTTMDFSIEEAPAEWMGLGGRGLTSTIVAAEVDPECHPLGPNNKLVFAPGM
LSGTSAANSGRNSCGAKSPLTGGIKESNVGGTSAAIMAKLGVKALIIEGMPKEGAPFYHL
HITKEKVEFFPVPELVGKNNYEVLDYMLEKYHKKVAVMSIGTPGEMRMNLANISVKDPGG
KLRSHGRGGMGAVMGSKKVKCITVDAESYNEITLANPEKFKEASKIFTKTLQENPISGQG
LPAFGTNVLVNILNEAGGLPTRNFREGRWEFAENICGETMAENIKARGGKTTHGCHAGCV
IQCSQIYNDADGNYLTSGFEYETIWAFGSNAGIQDLDQIAKIDALMDDLGVDSIETGVTL
GIAVDAGIVNYGDGEKIYDLIKNDIAKGTPLGRILGGGTHLVGKLYGLVRVPTVKGQGMP
AYEPRAVKGQGVTYATSTMGADHTAGYAVATNILNSGGYVDPLKKEGQIILSRNLQIATA
AVDSTGMCIFVAFPLLDDPKSLTALVDMINARFGTSLTGDDVTNLGMKILKTERAFNLKA
GLTPSDDRLPEFMKYESLPPHNVVWDFTNEELDSFWDF
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgttagacaaaatctaccgcgtcaatatgacgactatggatttttctatagaagaggca
cccgctgagtggatggggcttggcggtcgaggtcttacttcaaccattgttgcagccgaa
gttgaccctgagtgtcatcctctaggacccaacaacaaactcgtctttgctccgggtatg
ctctcaggcacaagcgctgctaacagtggcaggaactcctgtggagccaaaagcccgctt
acaggcggaatcaaagaatccaatgtcggtggaaccagcgcagcgatcatggccaaacta
ggcgtcaaagcgctcatcatcgaaggaatgcctaaagaaggggcacctttttaccatctg
cacatcacaaaagagaaggtcgaattcttccctgtacccgaacttgtaggcaaaaacaac
tacgaagtgctcgattatatgcttgagaaatatcacaaaaaagtggcggtgatgagcatc
gggactcccggagagatgcgcatgaatctcgccaacatctccgtcaaagatcccggaggc
aagctacgaagccacggtcgaggcggcatgggtgcagtgatgggctctaagaaggtcaaa
tgcatcaccgtggatgctgagagctacaatgagatcactctcgccaatcctgaaaaattc
aaagaggcgagcaaaattttcaccaaaaccctccaagagaatcccatcagcggccaaggc
ctacccgcctttggaaccaatgtccttgtcaatattcttaatgaagcaggggggcttccc
acgcgaaacttcagagagggtcgatgggaatttgccgagaatatctgcggtgagacaatg
gcagaaaatatcaaggctcgcggcggaaagaccacgcatggatgccacgcaggatgcgtg
attcagtgttcccaaatctataacgatgcggatggaaactacctcacttcaggctttgag
tatgagactatttgggcgtttggctccaatgcaggaatccaagacttagaccaaatcgcc
aaaatcgatgcactcatggatgatcttggggtcgattcgattgaaacaggggtcacccta
ggcatcgccgtggatgcgggaatcgtcaattatggcgatggagagaagatttatgacctc
atcaaaaacgatattgccaaaggaactcctttgggcagaatcttagggggcggaacccat
cttgtcgggaagctctatggcttagtgcgcgttccgaccgtcaaaggacaagggatgccc
gcctatgagccccgcgctgtcaaaggacaaggggtcacctacgccacctccacaatgggt
gctgaccacaccgctggctatgcggtcgcgaccaacatccttaatagcggtggttatgtc
gatccactcaaaaaagagggtcaaatcatcctctctcgtaacctccaaatcgccaccgcc
gcggtggatagcacaggtatgtgtatctttgtcgccttccctttgctcgatgacccaaaa
tcactaaccgcgctagtggatatgatcaacgcgcgctttggcacctccctcacaggagat
gatgtcaccaatctaggaatgaaaatcctaaagaccgagcgcgccttcaacctcaaagca
ggtctcaccccctcagatgatcgcctgcctgaattcatgaaatacgaaagcctccctccc
cataatgtcgtgtgggatttcaccaacgaggagctcgattccttttgggatttctag

  All links  
No link information was found.   
DBGET integrated database retrieval system