KEGG   Wolinella succinogenes: WS2001Help
Entry
WS2001            CDS       T00146                                 

Definition
(GenBank) PHOSPHOMANNOMUTASE
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
wsu  Wolinella succinogenes
Pathway
wsu00010  Glycolysis / Gluconeogenesis
wsu00030  Pentose phosphate pathway
wsu00051  Fructose and mannose metabolism
wsu00052  Galactose metabolism
wsu00230  Purine metabolism
wsu00500  Starch and sucrose metabolism
wsu00520  Amino sugar and nucleotide sugar metabolism
wsu00521  Streptomycin biosynthesis
wsu01100  Metabolic pathways
wsu01110  Biosynthesis of secondary metabolites
wsu01120  Microbial metabolism in diverse environments
wsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS2001
   00030 Pentose phosphate pathway
    WS2001
   00051 Fructose and mannose metabolism
    WS2001
   00052 Galactose metabolism
    WS2001
   00500 Starch and sucrose metabolism
    WS2001
   00520 Amino sugar and nucleotide sugar metabolism
    WS2001
  Nucleotide metabolism
   00230 Purine metabolism
    WS2001
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    WS2001
Enzymes [BR:wsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     WS2001
    5.4.2.8  phosphomannomutase
     WS2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAE11003
UniProt: Q7MQU6
Position
1902042..1903421
Genome map
AA seq 459 aa AA seqDB search
MQTIFREYDIRGIYPTELTQESVRAIGFLLGERVRARGGKYLAIGHDARTHSRELFTWLS
EGVAGADIEILDLGLIPTPVAYFSLFNSFEGITPDGSVMITGSHNPPEYNGFKITLFKEP
FFGEAITALGEEAQKLIEAKISCSKPPKIHFADALGRYITYMKEEFKALSSLSIPLSIDC
GNGVAGVALEPILKALNLECEVLYGEPDGRFPNHHPDPSDPHNLEDLQALLKKRGGLGFA
FDGDADRIAVLTPKYIFKGDELAVIFAKQMKNPLVIGEVKCSMSMYEEINKIGQAVMYKT
GHSNLKVKLKELGAHLAAEVSGHLFFNDRYFGYDDAIYAALRTMELLLLGINLDLEKESL
PPLFSTEELKVKTTEEKKFPLMERIKALLLEKKESLPPILEVIDVDGIRVIFEEGWGLVR
ASNTTPVLVTRFEAKSQEKLALYQESLEALIHQAQQEQN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatttttcgagagtatgacattcggggaatctaccccaccgagctcacccaa
gagagcgtgagggcgattggctttttgctaggggagcgcgtgagggctaggggtggaaaa
tacctagccatcggacatgacgccagaacccactctagagagctcttcacttggctctct
gagggggtcgcaggagccgatattgagattcttgatctagggctcatccccactcccgtg
gcctatttttcactttttaactcttttgaaggaatcacgcctgatggctcggtgatgatc
acaggttctcacaacccccctgaatataatggctttaagatcacgctctttaaagagcct
ttttttggcgaagccatcaccgctcttggagaagaggcgcaaaaactcatcgaagctaaa
atctcctgctccaaaccccccaaaattcactttgcggacgctttgggtcgctatatcacc
tacatgaaagaggagttcaaggcgctctcatccctctctattcccctctctattgattgt
ggcaatggggtggcgggtgtggcgttagagcctatcttaaaggccttgaacctagaatgc
gaagtgctctatggcgagcctgatggacgctttcccaatcaccatccagacccctccgat
ccccacaatctagaggatttgcaagcgctcctcaaaaagcgtggtggccttggctttgcc
tttgatggggatgccgaccgaatcgcagtgctcacccctaagtacatctttaaaggggat
gagttggcggtcatttttgccaaacagatgaaaaatcccctcgtcattggcgaggtgaag
tgctccatgagtatgtatgaggagatcaacaaaataggtcaggcggtgatgtataaaaca
ggtcacagcaacctcaaagtgaaactcaaagagctaggagcgcatttagcggctgaagtg
agcggacacctctttttcaatgatcgctactttggctacgatgacgccatctacgcggca
cttcggacgatggaactactccttttgggaatcaatctagacttagagaaagagtcgctc
ccccctctcttctccaccgaagagctcaaagtcaaaaccaccgaggagaagaaattcccc
ttgatggaacgaatcaaagcgcttcttttagagaaaaaagagagtctcccccccatcttg
gaggtgattgacgtggatggaatccgagtgatttttgaagaaggatggggacttgtgcgc
gctagtaacaccacgcctgtgttagtgacccgctttgaggccaagagccaagagaaacta
gccctctatcaagaatcgcttgaagccctcatccaccaagcgcaacaagagcaaaattaa

DBGET integrated database retrieval system