KEGG   Wolinella succinogenes: WS2001Help
Entry
WS2001            CDS       T00146                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
wsu  Wolinella succinogenes
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS2001
   00030 Pentose phosphate pathway
    WS2001
   00051 Fructose and mannose metabolism
    WS2001
   00052 Galactose metabolism
    WS2001
   00500 Starch and sucrose metabolism
    WS2001
   00520 Amino sugar and nucleotide sugar metabolism
    WS2001
  Nucleotide metabolism
   00230 Purine metabolism
    WS2001
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    WS2001
Enzymes [BR:wsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     WS2001
    5.4.2.8  phosphomannomutase
     WS2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1902042..1903421
Genome map
AA seq 459 aa AA seqDB search
MQTIFREYDIRGIYPTELTQESVRAIGFLLGERVRARGGKYLAIGHDARTHSRELFTWLS
EGVAGADIEILDLGLIPTPVAYFSLFNSFEGITPDGSVMITGSHNPPEYNGFKITLFKEP
FFGEAITALGEEAQKLIEAKISCSKPPKIHFADALGRYITYMKEEFKALSSLSIPLSIDC
GNGVAGVALEPILKALNLECEVLYGEPDGRFPNHHPDPSDPHNLEDLQALLKKRGGLGFA
FDGDADRIAVLTPKYIFKGDELAVIFAKQMKNPLVIGEVKCSMSMYEEINKIGQAVMYKT
GHSNLKVKLKELGAHLAAEVSGHLFFNDRYFGYDDAIYAALRTMELLLLGINLDLEKESL
PPLFSTEELKVKTTEEKKFPLMERIKALLLEKKESLPPILEVIDVDGIRVIFEEGWGLVR
ASNTTPVLVTRFEAKSQEKLALYQESLEALIHQAQQEQN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccatttttcgagagtatgacattcggggaatctaccccaccgagctcacccaa
gagagcgtgagggcgattggctttttgctaggggagcgcgtgagggctaggggtggaaaa
tacctagccatcggacatgacgccagaacccactctagagagctcttcacttggctctct
gagggggtcgcaggagccgatattgagattcttgatctagggctcatccccactcccgtg
gcctatttttcactttttaactcttttgaaggaatcacgcctgatggctcggtgatgatc
acaggttctcacaacccccctgaatataatggctttaagatcacgctctttaaagagcct
ttttttggcgaagccatcaccgctcttggagaagaggcgcaaaaactcatcgaagctaaa
atctcctgctccaaaccccccaaaattcactttgcggacgctttgggtcgctatatcacc
tacatgaaagaggagttcaaggcgctctcatccctctctattcccctctctattgattgt
ggcaatggggtggcgggtgtggcgttagagcctatcttaaaggccttgaacctagaatgc
gaagtgctctatggcgagcctgatggacgctttcccaatcaccatccagacccctccgat
ccccacaatctagaggatttgcaagcgctcctcaaaaagcgtggtggccttggctttgcc
tttgatggggatgccgaccgaatcgcagtgctcacccctaagtacatctttaaaggggat
gagttggcggtcatttttgccaaacagatgaaaaatcccctcgtcattggcgaggtgaag
tgctccatgagtatgtatgaggagatcaacaaaataggtcaggcggtgatgtataaaaca
ggtcacagcaacctcaaagtgaaactcaaagagctaggagcgcatttagcggctgaagtg
agcggacacctctttttcaatgatcgctactttggctacgatgacgccatctacgcggca
cttcggacgatggaactactccttttgggaatcaatctagacttagagaaagagtcgctc
ccccctctcttctccaccgaagagctcaaagtcaaaaccaccgaggagaagaaattcccc
ttgatggaacgaatcaaagcgcttcttttagagaaaaaagagagtctcccccccatcttg
gaggtgattgacgtggatggaatccgagtgatttttgaagaaggatggggacttgtgcgc
gctagtaacaccacgcctgtgttagtgacccgctttgaggccaagagccaagagaaacta
gccctctatcaagaatcgcttgaagccctcatccaccaagcgcaacaagagcaaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system