KEGG   Wolinella succinogenes: WS2110Help
Entry
WS2110            CDS       T00146                                 

Gene name
THRC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
wsu  Wolinella succinogenes
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WS2110 (THRC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WS2110 (THRC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    WS2110 (THRC)
Enzymes [BR:wsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     WS2110 (THRC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1995074..1996522
Genome map
AA seq 482 aa AA seqDB search
MLIETRGNDSQKPLNVEFSHAILNPDASFGGLYAPEALPILGQEARMRLKDLSYAKLAKE
IFALLGIELEEEILHEALSLYDHFDDPAHPAPLVPLKRDLSVLELYHGPTRAFKDMALQP
FGRILSRLAQQRGERYLILAATSGDTGPATLESFANQKNIQVVCLYPQGGTSDVQRLQMT
TQEAENLKVLGIHGDFDDAQAALKSLLKDDHFRASLTQKGISLSAANSVNFGRIAFQIIY
HAYASLRSDSPIDVIVPSGNFGNALGAFYAKLMGFGIGKIMIASNANNILTELITTGIYD
IRGKTLKKTQSPAMDILKSSNVERVLFALLGAQRTKTLMENLEKEGFYALNASELEKLQE
HFVALFCEDSEGERIIREYAKAGYLMDPHTATGIKAYEDLESDSQTLKVLCSTAEWTKFA
PTVAKALGKEGVRDLEALHYVKEALGVEIHPAINSLFAKKEIHTEVIQKEKIKEQILAWL
GA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgctcatcgagaccagagggaacgattcccaaaagccactaaatgtcgaattcagccac
gccatcctcaatcctgatgccagctttggcggactctacgcacctgaggcactccctatt
ttagggcaagaggcgagaatgcgccttaaggatctctcctacgccaaactagccaaagag
atctttgccctcttgggaattgagcttgaagaggagattcttcatgaggctctctcgctc
tatgaccattttgatgaccctgcccaccctgcgcccttggtaccgctaaagagagacttg
agcgtcctagagctctaccatggacccacgcgtgcctttaaagatatggcgcttcagccc
tttggccgtatcctctcccgtctcgctcagcaaagaggagagcgctacctcatcctcgcc
gccaccagcggagatacaggccctgccacactagagagcttcgccaaccaaaaaaatatc
caagtcgtctgcctctatccccaagggggcaccagcgatgttcagcgcctccagatgacc
acacaagaggcggagaatctcaaagtgctgggcatccatggagactttgatgatgcccaa
gctgcgctcaaaagccttcttaaggatgaccattttagggcctctttgacccaaaaaggg
atttcgctctccgcggccaactccgtcaattttggccgaatcgcctttcagattatctac
cacgcctacgcctctctaaggagcgattctcccattgatgttattgttcctagcggtaat
tttgggaacgctttgggcgctttttacgccaagcttatgggctttgggattggcaaaatc
atgatcgctagcaacgccaacaacattctcactgagctcatcaccacaggaatctacgat
attcgaggaaaaaccctcaaaaaaactcaatctcctgccatggatatcctcaaaagctcc
aatgtggagcgtgttctctttgcactcttgggtgcgcaaagaaccaaaaccctcatggag
aatctcgaaaaagagggcttttatgccttaaacgcttcggaattagaaaagcttcaagag
cactttgtagcgctcttttgtgaggatagcgaaggggagagaatcatccgtgaatacgcc
aaagcaggctaccttatggatccccacaccgccacaggaatcaaggcctacgaagaccta
gagagcgactctcaaaccctcaaggtgctctgctcgaccgcggagtggacgaagtttgcc
cccaccgtcgccaaagccctaggcaaagagggggtgcgtgatttagaggcactccactat
gtgaaagaggcgctaggggtggagatccaccctgccatcaattctctctttgccaaaaaa
gagattcataccgaagtgatccaaaaagagaagatcaaggaacagattctcgcgtggcta
ggagcctag

DBGET integrated database retrieval system