KEGG   Wolinella succinogenes: WS2128Help
Entry
WS2128            CDS       T00146                                 

Definition
ferrodoxin oxidoreductase beta subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
wsu  Wolinella succinogenes
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WS2128
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS2128
   00020 Citrate cycle (TCA cycle)
    WS2128
   00620 Pyruvate metabolism
    WS2128
   00640 Propanoate metabolism
    WS2128
   00650 Butanoate metabolism
    WS2128
  Energy metabolism
   00680 Methane metabolism
    WS2128
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    WS2128
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     WS2128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2013839..2014783)
Genome map
AA seq 314 aa AA seqDB search
MNEIKNLKQYSKAAERFEGAHLLCPGCAHGMIVREVLNATDDPLILSSATGCLEVSTAVY
PYTSWDVPWIHIGFENSSTAVAGAEAMYKALERKGKLYSEKKPKFVAFGGDGSTYDIGFQ
YISGCFERGHNMTYICLDNEVYANTGGQRSGSTPIGASTTTTPAGRVSYGKKDKKKDILQ
IMAAHGAPYVAQVAPNKWKDMAKKLKMALETEGPTFINAMSACTTEWKFESNLTVEVSDL
AVDSLVFPLYEIINGTELNITYRPKNIVPVRDYLAAQGRFKHLFKKENEHIIEQWQKEVD
ARWVYLQKREEARV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagattaagaatcttaaacaatactccaaagccgcggagcgtttcgaaggagcc
caccttctttgccctggttgtgcgcacggcatgattgtccgcgaagtgctcaacgccacc
gacgatcctttgattctcagtagcgccacagggtgtcttgaagtgagcaccgccgtttac
ccctacacctcttgggatgtgccttggattcacattggctttgaaaatagctccaccgca
gtcgcaggagccgaggcgatgtataaggcgctggagcgcaaaggcaagctctactccgag
aaaaagcccaaatttgtcgcctttggtggagatggctcgacctatgatattgggtttcag
tacatcagcggctgttttgagcgcggtcacaatatgacttatatctgtcttgataacgaa
gtctacgccaacacgggaggacaaagaagcggctcgacccctattggcgcgagtaccacc
accaccccagcgggtcgtgtgagctatggaaagaaagacaagaaaaaagacattctccaa
attatggctgctcatggtgctccctatgtggcgcaagtcgctcccaacaagtggaaggac
atggccaaaaaacttaaaatggcgcttgaaaccgaaggtcctacctttatcaatgcgatg
agtgcttgcaccacggagtggaaatttgagtccaacttgaccgtagaagtgagcgatttg
gcggttgattctttggtcttccctctttatgagatcatcaatggcaccgagcttaatatc
acctatcgacctaaaaatattgttcctgtgagagactaccttgccgctcaaggacgattt
aaacacctctttaaaaaagagaatgaacatatcatcgagcagtggcaaaaagaggtcgat
gctagatgggtctatctccaaaaaagggaggaggcgagggtctaa

DBGET integrated database retrieval system