KEGG   Wolinella succinogenes: WS2130Help
Entry
WS2130            CDS       T00146                                 

Definition
(GenBank) PYRUVATE SYNTHASE ALPHA SUBUNIT
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
wsu  Wolinella succinogenes
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS2130
   00020 Citrate cycle (TCA cycle)
    WS2130
   00620 Pyruvate metabolism
    WS2130
   00640 Propanoate metabolism
    WS2130
   00650 Butanoate metabolism
    WS2130
  Energy metabolism
   00680 Methane metabolism
    WS2130
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    WS2130
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     WS2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2014803..2016026)
Genome map
AA seq 407 aa AA seqDB search
MAEKMELHEIEVWDGNMAATHAMRQARIDVVAAYPITPSTPIVMNYSSFLADGYIDGEFV
MVESEHAAMSGCVGAAAAGGRVATATSSQGFALMVEVLYQASGMRLPIVLNVVNRALAAP
LNVNGDHSDMYLGRDAGWVNLCTYNPQEAYDFNLMAFKIAEDYDVRLPVMVHQDGFICSH
TAQTVRPLQDDEAYAFIGDYKPKNPMLDFSKPATYGAQTEEDWHFEHKARHHNDLMNAFP
VIERVFKEFKELTGREYKVIEEYDMEDAEVAIVALGTTVESARIAAKAARAGGIKAGVVS
LRVLRPFPYKMIAEALKDCKAAAFLDRSLPAGAMGMLFNECAAALYQFEGSKRPILTNYI
YGLGGRDMKQSDLLQIYKEQKQNADAGKLTVPTQQFIGLRGPKLGFN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagatggaattgcacgaaatagaggtgtgggatggcaacatggcggcgact
cacgccatgagacaagcgagaatcgatgtagtggcggcgtatcctatcacgccctccacg
cctattgtgatgaactacagtagcttcttggcggatggctacattgatggtgaatttgtg
atggtcgaatcagagcacgcagccatgagtggctgtgtgggtgcagccgcagcgggaggt
cgggtcgccaccgcgacaagctcccagggctttgcgctcatggtggaggtgctctatcag
gcttcagggatgcgccttcctatcgtactgaatgttgtgaatcgcgctctagctgcccct
ctcaacgtgaatggtgatcactctgatatgtatttgggtcgagatgcaggatgggtcaat
ctctgcacctataaccctcaagaggcttacgacttcaatctcatggcgtttaaaatcgct
gaagattatgatgtgagactgcctgtgatggtgcatcaagatggattcatctgttctcac
accgcacagaccgtgcgacccttgcaagatgatgaggcttatgcctttattggggactat
aaacccaagaatcctatgcttgatttcagcaagcctgccacctatggggcgcaaactgaa
gaagactggcatttcgagcacaaagcacgccatcataatgaccttatgaatgctttccct
gtgattgagcgggtctttaaagagtttaaggagcttacggggcgagagtataaggtgatt
gaggagtatgacatggaagatgctgaagtggctatcgtcgcacttggcaccactgttgaa
tcggcaagaatcgcggctaaggcggctagagctgggggaatcaaagcgggtgtggtttca
cttcgcgtgcttcgcccctttccttacaaaatgattgctgaggcactcaaagattgcaaa
gccgcggccttccttgatcgaagtcttcctgctggagcgatgggaatgctctttaacgag
tgtgccgccgctctctatcaattcgagggctctaaaaggcctatcctcaccaactatatt
tatggcttgggcggacgcgatatgaagcagtcagaccttttgcagatctacaaagagcag
aagcaaaacgccgatgcaggcaagctcaccgttcccacccagcagtttattggtcttcgc
ggacctaaacttggcttcaattaa

DBGET integrated database retrieval system