KEGG   Wolinella succinogenes: WS2130Help
Entry
WS2130            CDS       T00146                                 

Gene name
porA
Definition
pyruvate flavodoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
wsu  Wolinella succinogenes
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:wsu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:wsu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:wsu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:wsu00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:wsu00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:wsu00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:wsu00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2014803..2016026)
Genome map
AA seq 407 aa AA seqDB search
MAEKMELHEIEVWDGNMAATHAMRQARIDVVAAYPITPSTPIVMNYSSFLADGYIDGEFV
MVESEHAAMSGCVGAAAAGGRVATATSSQGFALMVEVLYQASGMRLPIVLNVVNRALAAP
LNVNGDHSDMYLGRDAGWVNLCTYNPQEAYDFNLMAFKIAEDYDVRLPVMVHQDGFICSH
TAQTVRPLQDDEAYAFIGDYKPKNPMLDFSKPATYGAQTEEDWHFEHKARHHNDLMNAFP
VIERVFKEFKELTGREYKVIEEYDMEDAEVAIVALGTTVESARIAAKAARAGGIKAGVVS
LRVLRPFPYKMIAEALKDCKAAAFLDRSLPAGAMGMLFNECAAALYQFEGSKRPILTNYI
YGLGGRDMKQSDLLQIYKEQKQNADAGKLTVPTQQFIGLRGPKLGFN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaagatggaattgcacgaaatagaggtgtgggatggcaacatggcggcgact
cacgccatgagacaagcgagaatcgatgtagtggcggcgtatcctatcacgccctccacg
cctattgtgatgaactacagtagcttcttggcggatggctacattgatggtgaatttgtg
atggtcgaatcagagcacgcagccatgagtggctgtgtgggtgcagccgcagcgggaggt
cgggtcgccaccgcgacaagctcccagggctttgcgctcatggtggaggtgctctatcag
gcttcagggatgcgccttcctatcgtactgaatgttgtgaatcgcgctctagctgcccct
ctcaacgtgaatggtgatcactctgatatgtatttgggtcgagatgcaggatgggtcaat
ctctgcacctataaccctcaagaggcttacgacttcaatctcatggcgtttaaaatcgct
gaagattatgatgtgagactgcctgtgatggtgcatcaagatggattcatctgttctcac
accgcacagaccgtgcgacccttgcaagatgatgaggcttatgcctttattggggactat
aaacccaagaatcctatgcttgatttcagcaagcctgccacctatggggcgcaaactgaa
gaagactggcatttcgagcacaaagcacgccatcataatgaccttatgaatgctttccct
gtgattgagcgggtctttaaagagtttaaggagcttacggggcgagagtataaggtgatt
gaggagtatgacatggaagatgctgaagtggctatcgtcgcacttggcaccactgttgaa
tcggcaagaatcgcggctaaggcggctagagctgggggaatcaaagcgggtgtggtttca
cttcgcgtgcttcgcccctttccttacaaaatgattgctgaggcactcaaagattgcaaa
gccgcggccttccttgatcgaagtcttcctgctggagcgatgggaatgctctttaacgag
tgtgccgccgctctctatcaattcgagggctctaaaaggcctatcctcaccaactatatt
tatggcttgggcggacgcgatatgaagcagtcagaccttttgcagatctacaaagagcag
aagcaaaacgccgatgcaggcaagctcaccgttcccacccagcagtttattggtcttcgc
ggacctaaacttggcttcaattaa

DBGET integrated database retrieval system