KEGG   Wolinella succinogenes: WS2131Help
Entry
WS2131            CDS       T00146                                 

Gene name
porD
Definition
pyruvate flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
wsu  Wolinella succinogenes
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WS2131 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS2131 (porD)
   00020 Citrate cycle (TCA cycle)
    WS2131 (porD)
   00620 Pyruvate metabolism
    WS2131 (porD)
   00640 Propanoate metabolism
    WS2131 (porD)
   00650 Butanoate metabolism
    WS2131 (porD)
  Energy metabolism
   00680 Methane metabolism
    WS2131 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    WS2131 (porD)
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     WS2131 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2016036..2016428)
Genome map
AA seq 130 aa AA seqDB search
MNYKGWNEFEIGSLLFPFEKEGEKNVEKHAEERDYNSDNSYTASTAHWRVEKPVYNPEGC
IHCYFCWLYCPDSSILVRSEKMTGVDYVHCKGCGVCVSVCPTNPKSLLMFNDHESEEAAL
ASWPKKEEKK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gtgaactacaaaggctggaatgaatttgaaattggttctctactctttccttttgagaaa
gagggtgagaaaaatgtcgaaaagcacgccgaagagagagactataactccgataactcc
tacacggcaagcacagcgcactggcgcgtagagaagcctgtttacaatcctgagggctgt
attcactgctacttctgttggctctactgccccgattcttcaattttggtgagaagcgag
aagatgacaggcgtcgattatgtgcattgcaaaggctgtggtgtttgcgtgagcgtctgc
cccaccaaccctaagtcccttttgatgtttaacgatcacgagagcgaggaggcagccctt
gcttcttggcctaaaaaagaagagaaaaagtaa

DBGET integrated database retrieval system