KEGG   Wolinella succinogenes: WS2132Help
Entry
WS2132            CDS       T00146                                 

Gene name
porC
Definition
pyruvate flavodoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
wsu  Wolinella succinogenes
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wsu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WS2132 (porC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WS2132 (porC)
   00020 Citrate cycle (TCA cycle)
    WS2132 (porC)
   00620 Pyruvate metabolism
    WS2132 (porC)
   00640 Propanoate metabolism
    WS2132 (porC)
   00650 Butanoate metabolism
    WS2132 (porC)
  Energy metabolism
   00680 Methane metabolism
    WS2132 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    WS2132 (porC)
Enzymes [BR:wsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     WS2132 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2016438..2016998)
Genome map
AA seq 186 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLADVIAGTGKEVQAFAFYGSAKRGAAMTAYNRIDDQAILN
HEKFMNPDYVLVIDPGLTYITDICANEKSSTKYIITTHLSKEELLAKKPDLAGKEVYVLD
CIQISLDTLGKAIPNAPMLGAFIKVSGALELDFFLNAFKKVLGKKLPQKVIDANMVAIKR
AYDEVK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgctagaaataaggtggcatagccgcgctggtcagggcgcggtgacgggagcaaaaggt
ttggctgacgtgatcgctggaacaggcaaagaggttcaagcgtttgcgttttatggttcg
gccaagcgcggggcggccatgacggcctacaatcgaatcgatgatcaagcgattcttaac
cacgaaaaattcatgaatcccgactatgttttggtgattgatccaggtttaacctatatc
accgacatctgtgccaacgaaaagtcctccaccaaatatattatcaccacccacctaagc
aaagaggagctcctcgctaagaagcccgatttggcaggcaaagaggtctatgtgctagac
tgtattcagatttcgctcgacaccttgggcaaagcgattcctaatgctccgatgcttggc
gctttcatcaaggtctctggagcgcttgagcttgacttctttttgaacgccttcaaaaaa
gtcttaggcaaaaagcttccccaaaaagtgattgatgccaacatggtcgccatcaagcgc
gcctatgatgaagtgaagtaa

DBGET integrated database retrieval system