KEGG   Wolinella succinogenes: WS2192Help
Entry
WS2192            CDS       T00146                                 

Gene name
PAB1605
Definition
asparagine synthetase (glutamine-HYDROLYZ (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
wsu  Wolinella succinogenes
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:wsu00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2071678..2073498)
Genome map
AA seq 606 aa AA seqDB search
MCGILGYLRKGSAGQSQLSCEQFNQILSKIAHRGPDHQDFVWFNEPEYQLYLGHVRLSII
DLDERASQPMLFKDRYLLVFNGEIYNYRELKEKLLLQGYGFATQSDSEVLLAAYDFWGET
CVEHFNGMWAFAIYDKKRHSLFCSRDRFGVKPFYFYENEEIFVFASEIKALLPFFKEAKL
NPKVILPYLARGFLDGGSETFFDGVYRLEASSNLFYDLRGKQKSFQTYYSILLNPLSAKE
REIPSSAKELLSLLRQSVSLRLRSDVRVGACLSGGLDSSGVAALASQQYDFGEKLVAIHA
KSSLKESDESSYAIEVANHLGLDLHMVEPSFEDFCESLDDLFYTQEEPFGSTSMFMQYFV
MKKAKELGCKVMLDGQGADEVFLGYEHYFHNIFKDLRDRKFFLENDFFKDLKTFRYTKEQ
ILEELKKADDAGVAWDVIKNRGNICSRYLCREWLDSYIAPVKTIQEFQKREIFYNHLPSL
LRYEDRDSMRFGIETRLPYLDYRIVEWVLALPTEVKFQQGYLKFALREALEISGLLPKSI
VWRYNKMGFESPQKLWIDRYRFEMMKVIEGSEIIRDIFFKVDIRRDDFLWKLFSIAKWEK
MFNVKL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggaatcttagggtatcttaggaagggttcggctggacaaagtcagctctcttgt
gaacaattcaatcaaatcctctcaaagattgcccatcgtggtccagatcatcaagatttt
gtgtggtttaatgagccagagtatcagctctatctagggcatgttcgactctcaatcatt
gatttggatgagagggcctcccagccgatgctttttaaggatcgctatcttctggtgttc
aatggtgagatatataactacagagagctcaaagagaagcttttgcttcaggggtatggc
tttgccactcaaagcgattcagaggtgcttttagcggcttatgacttttggggagagact
tgcgtagagcatttcaatggaatgtgggcttttgccatctacgacaaaaagagacacagc
cttttttgcagtcgagatcgttttggggtgaaacctttctatttctatgaaaatgaggag
atttttgtttttgcttcagagatcaaagccctattgccattctttaaggaggccaaactc
aatcctaaagtgattcttccctacctagcgagaggttttctagatggaggcagtgaaacc
ttttttgacggagtttatcgtcttgaggcttcttctaatttgttttatgatctgcgcggc
aagcagaagagttttcagacctactactcgattctcctcaatccattatctgccaaagag
agagagattccaagtagtgccaaagagcttttgtcactgctgaggcagtcggtttccctg
cgcttgcgctcggatgttcgtgtgggagcgtgcctgagcggaggattggatagctctggg
gtggcggcactggcgagccaacaatatgattttggtgagaagcttgtggccattcacgcc
aaatcaagtcttaaagagagtgatgagagctcctatgcaatcgaggtggctaaccatttg
gggttggatttgcatatggtcgagcctagctttgaagatttttgtgagagcttggatgat
ctattctacacccaagaagagccttttggtagcacctctatgttcatgcaatattttgtc
atgaaaaaggccaaggagcttgggtgtaaagtgatgctggatgggcagggggctgatgag
gtttttttaggatatgagcactattttcacaatattttcaaagacttgagagatagaaaa
ttctttttagaaaatgatttttttaaagatttgaaaacttttcgatatacaaaagagcaa
atattagaagagttaaaaaaagcagatgacgcaggggtggcttgggatgttattaagaat
cgggggaatatttgctcaaggtatctttgcagggagtggcttgattcgtatattgctccc
gtaaagacgatacaagaatttcaaaaaagagaaattttttataatcatttgccttcactc
cttcgatacgaagatagagattcgatgcgatttggcattgagacgagattgccctatttg
gactatcgaattgtagagtgggtgctagccttgcccacggaggtgaaatttcagcagggt
tacttgaagtttgctctaagggaggcactggagatctctgggctgttgcccaagagtatt
gtatggcgatacaacaagatgggctttgaaagccctcaaaaactttggatcgaccgatat
agattcgagatgatgaaagtcattgaaggctcggagattattagggatatttttttcaag
gttgatattcggagagatgattttttgtggaagctttttagcatagccaaatgggagaag
atgtttaatgtcaaactttaa

DBGET integrated database retrieval system