KEGG   Wolinella succinogenes: WS2210Help
Entry
WS2210            CDS       T00146                                 

Gene name
clpP
Definition
ATP-dependent Clp protease proteolytic subunit (EC:3.4.21.92)
Orthology
K01358  
ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
Organism
wsu  Wolinella succinogenes
Brite
Enzymes [BR:wsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.92  endopeptidase Clp
     WS2210 (clpP)
Peptidases [BR:wsu01002]
 Serine Peptidases
  Family S14: ClpP endopeptidase family
   WS2210 (clpP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2092282..2092869
Genome map
AA seq 195 aa AA seqDB search
MNYIPYVIEKTGRGERSYDIYSRLLKDRIIMLSGEINDGVASSIVSQMLFLEAEDPEKDI
YLYINSPGGVITSGMSIYDTMNYVKPDICTICIGQAASMGAFLLSCGTKGKRFSLPNSRI
MIHQPLGGAQGQATDIEIQAKEILRLKSILNGILASNTGQPLEKIAKDTDRDFFMSAQES
KEYGLIDNVLEKSFK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatcccttatgtcattgagaagacaggcaggggcgagagaagctatgatatt
tactcacgacttctcaaagatcgaatcatcatgctaagcggcgaaatcaacgatggagtg
gcctcctccatcgtctcgcaaatgctttttttggaggcagaggatcctgagaaggatatc
tatctctacatcaactcccctggcggtgtgatcaccagcggtatgagtatctatgacacc
atgaactatgttaagcccgacatctgcactatctgcatcggtcaggccgcgagcatgggc
gcctttttacttagttgtggcaccaaagggaagcgattctccttgcccaacagtcgaatc
atgattcaccaacccctaggaggtgcacaggggcaggcaaccgatattgagattcaagcc
aaagagattctgcgcctcaaaagcattctcaatggaatcttggccagcaatacggggcaa
cccctagagaagatcgctaaagacaccgatagagattttttcatgagcgcccaagaatcc
aaagagtatggactcatcgacaatgtcctagaaaaaagttttaaatag

DBGET integrated database retrieval system