KEGG   Weeksella virosa: Weevi_0096Help
Entry
Weevi_0096        CDS       T01441                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
wvi  Weeksella virosa
Brite
Enzymes [BR:wvi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Weevi_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(104744..105205)
Genome map
AA seq 153 aa AA seqDB search
MKTSKKGAEFIADYEKFMSKPYLDQAGVPTIGYGATFYENGVKVKMTDPLITKDRALRLK
QYHLSVFEKTVNKLVKSNINQNQFDALVSFAYNVGESALKSSTLLRKVNANPNDPSILNE
FAKWNKVTVNGRKVISNGLTRRRKDEAEMYFSK
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatcaaaaaaaggcgctgaatttattgctgattacgaaaaatttatgtctaaa
ccttacttagatcaagcaggagtcccaactattggttacggtgcgacattctacgaaaat
ggtgtaaaggtaaaaatgaccgatccgctaatcaccaaagatcgtgcattgcgattgaaa
cagtatcatttatctgttttcgagaaaacagtaaataagttggtaaaatcgaacattaat
caaaatcaattcgatgccttggtgtcatttgcgtataacgttggcgaatcagctttgaaa
agttctacgcttttgcgaaaagtaaatgcaaatccaaatgatccaagcattttgaatgag
ttcgcaaaatggaataaagtgactgttaacggtcgaaaagtaataagtaacggattaaca
agaagacgaaaagatgaagcagaaatgtatttttcaaaataa

DBGET integrated database retrieval system