KEGG   Weeksella virosa: Weevi_0365Help
Entry
Weevi_0365        CDS       T01441                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
wvi  Weeksella virosa
Brite
Enzymes [BR:wvi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Weevi_0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(351907..352950)
Genome map
AA seq 347 aa AA seqDB search
MKKIIFYFFVMMFISSCNSDDIDYGEPLINEDYTLLYPDYFPDIANSSTQNSLTKQGVEL
GRKLFYDGRLSRNNTISCGFCHIQENAFTHHGHNVSHGIDGRLGIRNTPPIQNLAFTKHF
NWDGVLHDLSMQPLIPITTYEEMDSSMEDVVEKLKNDALYRKYFRVVFGDEEINGHRILL
ALDQFMGSVISANSKYDQYLQNKIALTAEEQKGLNLFQAKCSTCHSGALQTDQSFRNTGL
YYDPQYQDAGRFRVTLDSADWMKFRVPSLRNIELTAPYMHDGRFYSLEAVLNHYSNGIRN
TKNLDSVFLQGSRPGIPMTTEEKTAIIAFLKTLTDFDFINNPAYAEF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattattttttattttttcgtaatgatgttcatttcgagttgcaactcggat
gatatcgattacggagaacctttaattaatgaagattatactttgctatatccggattat
tttccagatatagcaaattcttctacccaaaattccttaacaaaacaaggagtagaattg
gggcgtaagttattttatgacggtcgtttatctaggaataatactatttcatgtggtttt
tgccatatccaagaaaatgcatttactcatcatgggcataacgtaagtcatgggattgat
ggacgtttagggattcgcaacacacctccaatacagaaccttgcttttaccaaacacttc
aattgggatggtgtactacatgaccttagtatgcaaccactaattcctattacaacgtac
gaagaaatggatagctcgatggaagacgtagtagaaaagttgaaaaacgatgctctttat
cgaaaatattttcgtgttgtttttggtgatgaagaaatcaatggacaccgcattctttta
gctttggatcagtttatgggaagtgtaatttctgctaattctaagtacgatcaatatctg
caaaataaaattgctttgacagctgaagagcaaaaaggactaaatttgttccaagcaaaa
tgcagcacttgccattctggagccctccaaaccgatcaaagtttcaggaatacgggcttg
tattatgatcctcaataccaggatgcaggcagatttcgggtaactttagattcggcagac
tggatgaagtttcgtgtaccaagtttgcgaaatatagagcttactgcaccctatatgcac
gatggacgcttttacagtttagaggcagttctcaaccattacagcaatgggatacgaaat
accaaaaacttagattctgtttttctacagggttctcgtccaggaatcccgatgacgacc
gaagaaaaaacagccataattgcatttctaaaaacactgaccgatttcgattttattaac
aatcctgcgtatgcagaattctaa

DBGET integrated database retrieval system