KEGG   Weeksella virosa: Weevi_0431Help
Entry
Weevi_0431        CDS       T01441                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
wvi  Weeksella virosa
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Weevi_0431
Enzymes [BR:wvi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Weevi_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
428683..429348
Genome map
AA seq 221 aa AA seqDB search
MIRSVLFTKEIPTQLIEQFLPDMDYRILPSLNIVITDRQTIENKINPTEKINLITSQNSV
KAIENIELTGDFYVVGKKTAQKLQAQNRSVVAVENYAAELFARHLSELKQTTIQFFCGNN
RRDYLVENLMNNNNQVNQIISYQSIPIENHVEKMYDAYAFFSPLSFTTFLQKNKIPTEAL
IFSVGTTTTEAIKERITNPIYTADEPLVEAVLKKIKKHRND
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgatctgttttgtttaccaaagaaatacctactcaactcatcgagcaatttttg
cccgatatggattaccgtattctaccttcgctaaacattgtgattaccgatcggcaaacg
atagaaaataaaataaatcctaccgaaaaaataaatctaattacgagtcagaacagcgta
aaggcgatagaaaatatcgaactcacaggagatttttatgtagtaggaaaaaaaacagct
caaaaattacaagctcagaatcgctcggtcgttgcagtagaaaattacgcagccgaattg
tttgctcgtcatttatcggagctgaaacaaaccacaattcagtttttttgcggcaacaat
cgccgtgattatttggtagaaaacttgatgaacaacaataatcaagtcaaccaaatcatt
agctatcaatcaattcctatcgaaaatcatgtagaaaaaatgtacgatgcttacgcattt
ttcagtccgttaagtttcaccactttcctacaaaaaaataaaataccgaccgaagcctta
atcttttcggttggcactaccaccaccgaagccattaaagaaagaattacaaaccctatc
tataccgccgatgaaccattagttgaagcggttttgaaaaaaataaaaaaacatcgaaat
gattaa

DBGET integrated database retrieval system